KEGG   Coprinopsis cinerea: CC1G_05502Help
Entry
CC1G_05502        CDS       T01275                                 

Definition
(RefSeq) hypothetical protein
  KO
K03441  aquaglyceroporin related protein, other eukaryote
Organism
cci  Coprinopsis cinerea
Brite
KEGG Orthology (KO) [BR:cci00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cci02000]
    CC1G_05502
Transporters [BR:cci02000]
 Other Transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    CC1G_05502
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-GeneID: 6015544
NCBI-ProteinID: XP_001838949
UniProt: A8P5I1
Position
11
AA seq 315 aa AA seqDB search
MSNRAAGVDTRSSLSASSSESKKFRVEHKEYTSPPYAERALDGTPPPPPGLSDQLGEAEH
TTSNTDLVDPKGASGNLSRWMRFRAAMREPMAEFLGTACLIIFGNGVNCQVVLSEDPGVA
ASPKGNYLSINVGWGVGVAMGVWLSGGISGGHINPAVTLALATFRGFPWRKVPGYILAQI
LGGIAGAAVIYGNYFQAINIIEGGSHIRTELTRGLFATYPKNCPPPAGLAPLLLFFLVLG
IGTSLGMQTGYAINPARDLGPRILTAMAGYGRAVFNFRSQYWFWCPFLAPILGAQVAAVI
YDGLLYTAEASRTTV
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaccgcgcagcaggagtcgacacccgctcatcgctctccgcgtcctcctccgag
tccaagaaattccgcgtcgaacataaagaatacacctcgcccccatacgctgaacgagcg
ctcgacggtacgccaccccctccgccagggctgtcggatcagcttggggaagcggaacat
accacttccaacaccgacctcgttgatcctaaaggcgctagtggaaacctaagtcgatgg
atgcggttccgagccgcgatgcgtgaaccaatggccgaattcctgggtacagcttgcttg
atcatttttgggaatggcgtgaattgccaggtcgtcttgtcagaggatcctggagtggcc
gcgtcgccgaagggtaattatctctccatcaatgtaggatggggtgtcggagtggcaatg
ggcgtctggttgtcgggagggatatcgggtggtcatatcaatccagcggtcaccctggcg
ctggccaccttccgcggcttcccctggagaaaggttccagggtacatccttgctcagata
ctgggcggcatcgccggagcagcagtcatctacggaaactacttccaagcgatcaacatc
atcgagggaggaagccacatccgcaccgagctcaccagagggctattcgcgacatatccc
aagaactgtcctccaccagctgggctggccccacttctcctcttcttcttggtacttgga
atcggtacttcgctcggcatgcaaacaggttatgccatcaatcctgcgagggaccttggt
ccgcgtatcttgaccgcgatggcgggatatggtcgagctgtgtttaactttaggagccag
tactggttctggtgccccttcttggcgcccatcctcggagctcaagtcgcagctgtcatt
tacgatgggcttctttacacggcagaggcttctcgcaccacggtataa

DBGET integrated database retrieval system