KEGG   Coprinopsis cinerea: CC1G_05865Help
Entry
CC1G_05865        CDS       T01275                                 

Definition
(RefSeq) decaprenyl-diphosphate synthase subunit 1
  KO
K05355  hexaprenyl-diphosphate synthase [EC:2.5.1.82 2.5.1.83]
Organism
cci  Coprinopsis cinerea
Pathway
cci00900  Terpenoid backbone biosynthesis
cci01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cci00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CC1G_05865
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:cci01006]
    CC1G_05865
Enzymes [BR:cci01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.82  hexaprenyl diphosphate synthase [geranylgeranyl-diphosphate specific]
     CC1G_05865
    2.5.1.83  hexaprenyl diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific]
     CC1G_05865
Prenyltransferases [BR:cci01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   CC1G_05865
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: polyprenyl_synt DUF5429
Motif
Other DBs
NCBI-GeneID: 6011245
NCBI-ProteinID: XP_001834728
UniProt: A8NLM6
Position
12
AA seq 505 aa AA seqDB search
MPGRLLVDVVTIVDDGDEFDWRLFTTFGTMYSCRNALRRLQTRRWYSTKGPDPVKFVEPQ
LNELRTSLLSMLGSGHAAISEITKYYFLHPSKHVRPVIVLLLSQATNGLGSDWSKKLWEA
QNQGGGARAEDLDAPLTRPDVLNDWNPSMPDGTSSFRPNFPIKPPKPHRPPISTPTNFAS
KPPSLHLPPYVLPTQVRLAQIVEMLHTASLLHDDVIDESALRRGAASAPSAFGNKQSVLG
GNFVLGRASAALSRLGDPEVTQLIAGVLSNLVEGEILQLKEIQLDGSPETASQRRQDAWN
IYLHKTYLKTASLMAKGARSAVVLGGCKEGEIWKEIAYAYGRNLGIAFQLVDDVLDYESA
SATLGKPGGADLELGLATGPALYAWEEYPEIGELICRKFEQPGDVERARDLVLRSSGVER
TKALAQEYASKAREVLQEIPDSDAKAALENCVRERLLVAQVPLMIRCVPGGQLGGPSCQR
KAKRAQISVSDALEEHPSPAQVGAT
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgcccgggcgcctcctcgtcgacgtcgtcaccatcgtggacgacggtgacgaatttgac
tggcggcttttcacgacgtttgggacgatgtacagctgccggaatgctctgcgacgtttg
caaactcgacgatggtattcgaccaaaggccccgacccagtcaagttcgttgagccccag
ttaaacgaactccggacctcattgttgtcgatgctggggtcaggtcatgctgcgatcagt
gaaataacaaagtattatttcttgcatccttcaaagcatgttcgtccagtcatcgtgctc
ttgttgtcacaggctacaaacggactaggctcagactggagcaagaagctctgggaagct
caaaaccagggaggcggggctcgagcagaggacttggacgcgcctctgacgcgaccagac
gttctcaatgactggaatccctcaatgccagatggaacctcatcatttcgtcccaatttc
cccatcaaaccaccaaaaccccatagaccaccaatatcaacacccacgaattttgcatcc
aagccaccatctctacatttgccaccttacgtcctacccacacaagttcggcttgcacaa
atcgttgaaatgctccacacagcttctcttctgcacgacgacgtgatcgacgaatcggca
ttgagacggggtgctgcttcagccccttcagcctttggtaacaagcagtcggtgctcggt
ggaaatttcgtccttggccgagcatctgctgcattgtcaaggctaggggacccagaagtc
acccagcttatcgctggcgtgctttccaaccttgtggaaggcgaaatcctgcagctgaag
gagatacaactggacggcagcccggaaaccgcgagtcagcgacgtcaagatgcctggaat
atatacctgcacaaaacctatctcaagacagctagtctgatggccaagggcgcgcgttca
gccgtcgttctcggagggtgcaaggagggagagatttggaaggagattgcgtacgcatac
gggaggaacctagggatcgcgttccagttggtggatgacgtactcgactacgagtctgcg
tctgcaacgctaggaaagccaggaggcgctgatttggagttgggattggcgactggacca
gcactctacgcttgggaggaataccccgagatcggggagctcatttgtcgcaagtttgaa
cagcccggtgatgtcgaacgggcgcgcgatttggtccttcgttcttcgggtgtcgagaga
acaaaagctctcgcacaggaatatgcgagcaaggctcgagaagtcctacaagagatacca
gacagcgacgccaaggctgcactggaaaactgcgtccgcgaaaggcttctcgtcgcccaa
gttccattgatgatccgctgcgtccctggaggtcaacttggagggcccagttgtcagagg
aaggccaagcgcgcccaaatctcagtttcagacgccttggaagagcatccatccccggcg
caagtgggcgccacctga

DBGET integrated database retrieval system