KEGG   Coprinopsis cinerea: CC1G_06324Help
Entry
CC1G_06324        CDS       T01275                                 

Definition
(RefSeq) endoglucanase
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
cci  Coprinopsis cinerea
Pathway
cci00500  Starch and sucrose metabolism
cci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CC1G_06324
Enzymes [BR:cci01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     CC1G_06324
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cellulase CBM_1
Motif
Other DBs
NCBI-GeneID: 6012780
NCBI-ProteinID: XP_001836239
UniProt: A8NTI7
Position
4
AA seq 380 aa AA seqDB search
MKSVLSPLSATVIALLSTAAVAVPPYGQCGGSGYTGPSDCDSGYTCVPVNQWYHQCQPGS
SAPTNPPNPPVATTTTTAPRPTNSACPGAVTKFRYFGVNQAGAEFGSNIIPGELGTHYIW
PAPSSIDFFVNEGFNTFRIPFQLERLNPPARGLTGSFEQPYLQDLKRTVDYITRNKNSFA
IIERWRNLATEFRDNDKVIFDVMNEPHTMDARVVFDLNQAAVNAIREAGATRQLILVEGT
SWTGAWTWTTTSGNGNVFQNIRDPNNNVAIQMHQYLDSDGSGTSPTCVSSSIGRERLAAA
TAWLKQHNLKGFLGELGAGSNPTCIEAIKGALCSLQESDVWIGWAWWAAGPWWGNYFQSI
EPPNGPALAQMYPQAIKPFI
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctgtgctctccccgctgtctgcaactgtgattgctctgttgagcactgcggct
gttgccgttcccccctacggccagtgcggtggctctggatacactggaccttccgactgt
gactctggctatacctgtgtcccggtgaaccaatggtaccaccagtgccaacccggtagc
tccgcccccaccaaccctcccaatccccctgtcgctactaccactaccactgcgcccagg
cccaccaacagtgcttgcccaggcgccgtcaccaagttccgctacttcggtgtcaaccaa
gctggtgctgagttcggcagcaacatcatccccggagagctcgggacccactacatctgg
cccgcccctagttccatcgacttcttcgttaacgaaggtttcaacactttccgaattccc
ttccaattggagcgactgaacccccctgctcgtgggttgaccggttccttcgagcagccc
tacctccaggacttgaagaggactgtcgactacatcacccgaaacaagaactctttcgcc
atcatcgaacggtggaggaaccttgcaactgaattcagggataatgacaaggttatcttt
gatgtcatgaacgagccccacactatggatgctcgtgtcgttttcgacctcaaccaagcg
gcggtcaatgctatccgtgaagctggtgctacccgccaattgatcctcgttgagggaacc
tcctggaccggtgcctggacctggactaccaccagcggaaacggcaacgtcttccagaat
atccgtgatcccaacaacaatgtcgccattcagatgcaccagtacctcgacagtgacggt
tcgggtacctctcccacttgtgtttccagctccatcggtcgcgagcgtctcgctgctgcc
actgcctggttgaagcaacacaacctcaagggcttcctcggtgaactcggtgctggttcc
aaccccacttgcattgaggccatcaagggtgctctctgctccctccaggagtctgatgtc
tggattggttgggcctggtgggctgctggtccctggtggggcaactacttccaatccatt
gagccccccaatggacccgctctcgctcagatgtaccctcaggccatcaaacccttcatc
taa

DBGET integrated database retrieval system