KEGG   Coprinopsis cinerea: CC1G_06564Help
Entry
CC1G_06564        CDS       T01275                                 

Definition
(RefSeq) exo-beta-1,3-glucanase
  KO
K01210  glucan 1,3-beta-glucosidase [EC:3.2.1.58]
Organism
cci  Coprinopsis cinerea
Pathway
cci00500  Starch and sucrose metabolism
cci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CC1G_06564
Enzymes [BR:cci01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.58  glucan 1,3-beta-glucosidase
     CC1G_06564
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cellulase
Motif
Other DBs
NCBI-GeneID: 6005653
NCBI-ProteinID: XP_001829227
UniProt: A8N2Z2
Position
1
AA seq 421 aa AA seqDB search
MRPSLSKLLLACLTSFGVASVSAQRWGFPYGEQKLRGVNLGGWLVTEPWITPSLFDNTGD
PRVIDEWTFGQYLDRGRAQAILRNHWDTFITEADFAEIAGAGLNHVRLPIGYWAFEVGPG
EPYISGQLPYLQRAIGWAEKYGLKVIIDLHGAPGSQNGFDNSGQKMDYPTWHTKQSNVDR
TNAVIKRIADMFKDSTAVVPMIAPLNEPAGYRGDDVLRVTRQFWYDSYGNIRYPYGSARQ
SDTVVMISDAFQPLSYWSGFMAYPGFEGVMIDTHHYQIFNDELNRMSPEQHIQMACSRGR
ELAASHLWIAVGEWSPARTDCARYLNGRGVGSRFEGTYPGSSHIGSCRSFTGPASGYSQS
YKNFLRQFWEAQTIAFERGGDGWIQWTWKAEEAHEWSYQAGLRNGWIPRNPTDRMYPNIC
G
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgcggccttcgctatcgaaactcctcctagcctgtctcacctccttcggtgtggccagt
gtcagcgcccagagatgggggtttccctatggagagcagaagctcaggggagttaacctt
ggtggctggctcgtgactgagccctggatcaccccgtccctgttcgataacaccggtgac
ccaagggtcatcgacgagtggacgtttggtcaatacctggaccgaggccgtgcacaagcc
attcttcgcaaccattgggacacgttcatcaccgaagccgactttgctgagattgctggc
gcaggcctcaatcatgttcgtctccccattggatactgggccttcgaagttggcccagga
gagccatacatttcaggacagcttccttacctccaaagagccattggctgggcggagaag
tacggtctcaaggtcatcatcgatctccatggtgctcctggcagccagaatggcttcgat
aattcaggccaaaagatggactacccaacctggcacaccaagcaatctaatgtcgatcgc
acgaatgccgtaatcaagagaatcgcagatatgttcaaggattcgactgctgtcgtcccc
atgattgcgcctttgaacgaacctgctggatatcgtggagatgacgtgctgcgagttacc
cgtcagttctggtacgacagctacggtaacattcgctatccctatggcagcgcaaggcag
agcgacactgtcgtcatgatctccgatgcgttccagcctctgagctattggagtggattc
atggcttatcctggattcgagggggttatgatcgacactcaccactaccagatcttcaat
gatgagctcaacaggatgagtcctgaacagcacattcaaatggcctgcagcaggggaaga
gaactggccgcttctcatctctggattgccgttggcgaatggtctcctgctcggactgac
tgtgccaggtacctcaacggtcgtggcgttggcagtcgcttcgaaggaacataccctggc
tcaagccacatcggcagctgccgcagtttcactggccctgcatccggatatagccaaagc
tacaagaacttcttgcgacaattctgggaggctcagaccatcgcattcgagaggggcggt
gatggctggattcagtggacctggaaggcggaggaggctcacgagtggtcgtatcaggct
gggttgaggaacggatggatcccaaggaacccgactgacaggatgtaccccaacatctgc
ggctga

DBGET integrated database retrieval system