KEGG   Coprinopsis cinerea: CC1G_07228Help
Entry
CC1G_07228        CDS       T01275                                 

Definition
(RefSeq) nitrite reductase
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
cci  Coprinopsis cinerea
Pathway
cci00910  Nitrogen metabolism
cci01100  Metabolic pathways
Module
cci_M00531  Assimilatory nitrate reduction, nitrate => ammonia
cci_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:cci00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    CC1G_07228
Enzymes [BR:cci01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     CC1G_07228
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 NIR_SIR Fer2_BFD NIR_SIR_ferr Pyr_redox Rieske_2 Rubredoxin_C Rieske
Motif
Other DBs
NCBI-GeneID: 6017145
NCBI-ProteinID: XP_001840498
UniProt: A8PD04
Position
6
AA seq 1161 aa AA seqDB search
MSATSEQSNNCVETTVNANGMNGHGPFTNGVNGHEHLADGANGHESSMNGVNGHGPVANG
LNGHDHGLTDSLKTIVDDAPPGKETIFVAFIEKLLNLDDKNKYFIVENLYLNPPSWYAEQ
QPDRFSYHLEEQVLSISPEDHLVHTSKNRSFKYDKCVIATGSRADLPPYISADTAEKTKG
VFVYRNIADLDGIISYAEKPEVKRAVVVGGGLLGLEAAKAVYDMPSISHVSIINRSAYPL
SRQLDSEAGEMVLHKIEAMGVQVLTRCSPSRQLTRPADDGSGDDVFCGFEFPDGSVYEAD
LVIYAIGIRSRDDVARASGIQCHPRFGIIVGDDLRTSAEDVYAIGECASWRENTYGLIGP
GIEMADILSFNFTQTDAHAPRLMNAPDLSTKLKFNFRLMGIDVASFGDFFADKRLPKGRT
QDVTQLAKSVTNGHANGKVAKVEIEFEEEPKQNGNSAGPLPTPKPSPSKRRKRGQDEPIN
CLVYKDPFTATYKKYIFTEDGKYLLGGMMVGDVSDFVKLVAIVKKKKQLEVLPSQFIISD
KKGEDDGGDLDDDAQVCSCHNVLKGDIVKAVQEGTCLTIPDLKCKTKVGTGCGGCMPLVT
SIFNSEMKKAGRVLNNNLCPHFAMSRTDLFSVIKVKQLRSFSEVMDAVGVNKASVGCELC
KPAVGSILSSLYNEHIMKPSHHQNQDTNDRFLANMQRNGTFSVVPRMTAGEVTPDGLIAI
GQIAKKYNLYTKITGGQRIDLFGAKKEDLPDIWEALGAAGFESGHAYGKSLRTVKSCVGT
TWCRYGVGDSVGLAVQLENRYRGVRSPHKFKGGVSGCVRECAEAQGKDFGLIATDKGWNI
FVGGNGGANPRHAELFAKDVPPSKVVRIIDRFLAYYIMTADKLQRTARWIENMEGGIQKL
QRVILDDELGICKDLDALMDNLVNTYEDEWAAVVKDPAKRKAFKQFVNTHETRPQSEMIT
ERGQPRPADWAKSYPPVKLSTGQLATPKEEWKWVTLAQKADLLVNDEGTSSAAVKYGESQ
LAIYHVPRRGYYRAFVLEHGIIGDTAEGSLYVSCPLHKRNFALTDGECLNDGEYQIMAFE
AREDPDGTGAIQVLLPPADDLDSLIATEKWLVRQAESEALGLNAATQIEILGPRGEILSG
LGVNGGGGCDSSACGDSKLEW
NT seq 3486 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccacctcggaacaatccaacaattgcgtggagacgactgtaaatgcgaacggc
atgaacggccatggacctttcaccaatggtgtcaatggccacgaacacttggcggacggc
gccaatggccatgaatcctcgatgaacggcgtcaacggccatggacctgtggcgaatggt
ctcaacgggcacgaccatgggttgactgatagtttgaagaccatcgttgacgacgctcct
ccggggaaggagactatcttcgtcgcattcattgaaaaactgctcaacctggacgacaaa
aataaatatttcatcgttgagaatctctacctgaaccctccctcgtggtacgcggagcaa
cagcccgatcggttcagttaccacttggaggaacaagtcctctccatctcacccgaagac
catctcgttcacaccagcaaaaaccgctcgttcaagtatgacaaatgtgtcatcgcgacc
ggttcacgcgcagatctaccaccctacatctccgccgacacagcggagaagaccaagggc
gttttcgtgtaccgaaatatcgcagacttggacggaatcatctcgtacgcggagaaacct
gaggtcaagcgtgctgtcgttgttggtggtgggttgctcggcttggaggcggcaaaggct
gtctacgacatgccttcgatctctcatgtcagcatcatcaatcggagcgcctacccgctg
tcccgtcaactagactcagaggccggggagatggtgctccacaagatcgaggcgatgggc
gtgcaggtgctcacccggtgttccccatctcgtcagcttacccgtccagctgacgatggc
tctggggacgatgtcttctgtgggttcgagtttccggacggttccgtgtacgaagcagac
ctcgtcatctacgccattggcatccgatctcgcgacgacgtggctagagccagcgggatc
cagtgccacccccgcttcggtatcatcgtgggggacgacttgaggacttcggcggaggac
gtttatgccattggggaatgtgccagttggagggagaatacctacggcctgatcggtcct
ggaatcgagatggccgatatcctttcgttcaactttacccaaacggacgcacatgcgcct
cgtttgatgaacgcgccagacctgagtacaaagctcaagtttaattttaggttaatggga
atcgatgttgcgtcatttggtgacttctttgcggataaacgtcttccaaagggccggacg
caggatgtcacacagcttgcgaagtcggtcaccaacggccacgcgaacgggaaggtggcc
aaagttgagattgaatttgaagaggaacccaagcagaatgggaattcagctggtccactc
cccacacccaagccctcaccctcgaagagacgaaagcgcggacaggacgagccgatcaac
tgcctcgtgtacaaggacccgttcaccgcgacgtacaagaagtacatctttaccgaagat
ggcaagtaccttctgggtggaatgatggtaggcgacgtcagcgactttgtcaagctcgtg
gctatcgtgaagaagaagaaacaactcgaagttcttccgtcgcagtttattattagcgac
aagaagggggaggacgatgggggtgacctcgacgatgacgctcaggtctgcagctgccat
aacgtcctcaaaggggacatcgtcaaagcggttcaggaaggaacgtgcttaaccatcccc
gacctcaaatgcaagactaaggttgggactgggtgcggaggctgtatgcccttagttacg
agcatcttcaactcggaaatgaagaaagcagggcgcgttcttaataacaacctctgccct
catttcgccatgagccggacggaccttttcagcgtcatcaaggtgaagcagcttcgcagc
ttctccgaggtgatggacgccgttggagtcaacaaggcctccgtgggctgcgaactgtgc
aaaccagccgtcggcagcatcctgtctagtttgtacaatgagcacatcatgaagccttct
catcaccagaaccaggacacgaatgacagattcctcgcgaacatgcagcgaaacggaact
ttcagcgtcgttccgcgtatgaccgccggagaggtcacaccagacgggcttattgccatt
ggccagatcgcgaagaagtataatctctacaccaagatcacgggtggtcagcgcatcgac
ctctttggagcgaagaaggaagatcttccggatatctgggaggccctgggtgccgctggc
ttcgaaagtggacatgcctacggcaagagcttgcgaacggtcaagtcatgtgttgggact
acgtggtgccgatacggcgtcggtgattccgtcggtctcgcggttcagctcgagaatcgg
tacagaggtgtgaggagcccgcacaagttcaagggcggtgtgtcgggatgcgtccgggag
tgtgcggaggcgcagggcaaggactttggactcattgcgactgacaaaggctggaacatc
ttcgtcggcggaaatggtggtgcgaatccgagacacgccgaactcttcgccaaagacgta
cctccttccaaggtcgtccgtatcatcgatcgattcctcgcatactacatcatgacagcc
gacaaactccaacgtacagcgaggtggatcgagaacatggaaggcggtattcagaaactc
caacgagtcatcctcgatgacgaactcggtatttgcaaagatctcgatgcattgatggac
aacctcgtcaacacgtacgaggacgaatgggctgcagttgtcaaagaccccgccaagcgc
aaagccttcaaacaattcgtcaacacccacgaaacccgccctcaaagcgagatgatcaca
gaacgcggccaaccacgtccagcagactgggccaaatcctaccctcccgtcaaactatcc
accgggcaactcgctacgcccaaagaagagtggaagtgggtcactctagcgcagaaggcc
gatctactggtcaatgatgaaggaacgtcgagtgcggctgtcaagtatggagagagccag
ttggcgatttatcatgttccaagaagagggtattatagagcgttcgtcctcgaacatggt
atcatcggagatacagccgaaggctcactctacgtctcctgccccctccacaagcgcaac
tttgctttaacagacggcgaatgcctcaacgacggcgagtaccaaatcatggcgttcgaa
gcgcgcgaagacccagacgggacgggtgccatccaggttctcctaccacccgcggatgac
ctcgactcgttgattgcgacggagaaatggcttgtacgacaggctgagtctgaggcgctg
ggtttgaatgcggcgacccagattgagattttggggccgcgaggggagattctttcaggt
ttgggtgttaatgggggcggaggatgtgattcgagtgcgtgtggggatagtaaattggag
tggtaa

DBGET integrated database retrieval system