KEGG   Coprinopsis cinerea: CC1G_07912Help
Entry
CC1G_07912        CDS       T01275                                 

Definition
(RefSeq) methionine-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cci  Coprinopsis cinerea
Pathway
cci00450  Selenocompound metabolism
cci00970  Aminoacyl-tRNA biosynthesis
cci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cci00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CC1G_07912
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CC1G_07912
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cci01007]
    CC1G_07912
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cci03016]
    CC1G_07912
Enzymes [BR:cci01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CC1G_07912
Amino acid related enzymes [BR:cci01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CC1G_07912
Transfer RNA biogenesis [BR:cci03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CC1G_07912
 Prokaryotic type
   Other AARSs
    CC1G_07912
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-GeneID: 6015806
NCBI-ProteinID: XP_001839197
UniProt: A8P6P3
Position
5
AA seq 516 aa AA seqDB search
MLFRILDICILCRPVKLLVGTDEHGLKIQQAAAKASTEVLTFCNELSQVFKDLSKKANIS
YTTFSRTTGDNHKELVAQVWRTLLDKGYIYKGEYEGWYSITDECFYTSAQIVQSPTSTAE
NPEYVSKETGSKVEWSKEYNYMFRLSMFRDALVKHYSDRSVVQPSQYNSVVLQMLGATED
SSGVELADISISRPRSRLTWGIPVPNDPEHTVYVWFDALLIYLSGVGYQVSGPPAVTGWP
PNLQVIGKDILRFHALYLPAILMALGAPSHAALKDLSATQILEKSVGLPKTLLTHAHWTV
SQQKMSKSVGNVVDPMQSVDKYGLDIVRFYLARVGGRFRDDVDWSFEQLEKHSKELQSLL
GNYLLRITSARITAAAAAGYEQQSEASPHALNLELAREVDALPRRVQELMNNLEVADALS
SILDVLKLANKVITDIAPWSKTCSPALVYETRRTALDTLRVTGICLQPFVPETSERLLDA
LGLAPEDRTWRSILEPAGKGERDKWQSRDVKSIRLF
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgctgttccgcatattggacatttgtatactctgtcgtcccgttaaactccttgttgga
accgacgaacatggactgaagattcagcaggctgcagcgaaggcttcgaccgaagtcctc
acgttctgcaatgaactgagccaggtgttcaaggacttgtcgaagaaggctaatattagc
tatacgacgttctcgaggaccacaggcgacaaccacaaggagctagtcgcccaagtctgg
aggacactgcttgacaaagggtatatctacaagggcgagtacgaaggctggtattcaata
acagacgaatgcttctacacctctgcccaaatcgttcagtccccgacatcgactgccgaa
aacccagaatacgtctccaaagaaaccggttcaaaggtcgaatggtcgaaggaatacaac
tacatgttccgcctgtccatgttccgggatgccctcgtcaaacactactcagaccgatcc
gtcgttcagccatcgcagtacaactcggtcgtactgcagatgttgggagcgacggaggac
agttctggagtcgagctcgccgacatctccatctcgcgacctaggtcgcgtttgacatgg
ggaatacctgtccctaacgacccggaacataccgtctatgtttggttcgacgccctgttg
atttacctctccggagtgggctatcaggtgtccggacccccggctgtcactggatggcca
cccaatttgcaggttattggaaaggatatcctcagattccatgccctgtatctcccggcc
attctgatggcattgggtgccccatctcacgctgccctcaaagacctctccgctacccaa
atcttggagaaatcagtcggccttcccaaaacgctcctgacacacgcccattggaccgtc
tcccagcagaagatgtccaagtccgtcggcaacgtcgtggatcccatgcagtcggttgac
aagtacggactcgacattgtgcgattctaccttgcacgagtgggagggaggttccgggat
gatgttgactggtctttcgagcagcttgagaaacattccaaagaacttcagtcactgctg
ggcaactacctgcttcgaatcacctctgcacgtataacagcggcagccgccgctgggtac
gagcaacaaagcgaagcatcgcctcacgccctcaacctcgaactggctcgcgaagtggac
gccctgccccgccgagttcaagagttgatgaacaatctggaagtagctgatgccctctcc
tcgatcctggacgtcttgaagctggccaacaaggttatcaccgatatcgccccatggtcg
aagacgtgctctccggcgctcgtttacgagactcgtcgaactgccctggacaccctgcgg
gtgaccggtatctgcctgcagcctttcgtccccgagacgtccgaacggcttctggatgcg
ttgggtctcgctcctgaggacaggacgtggcggagtattctagagcctgccgggaaagga
gaaagagataagtggcagagccgggacgtgaaaagtattcggttgttctaa

DBGET integrated database retrieval system