KEGG   Coprinopsis cinerea: CC1G_08311Help
Entry
CC1G_08311        CDS       T01275                                 

Definition
(RefSeq) monocarboxylate permease
Organism
cci  Coprinopsis cinerea
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-GeneID: 6017841
NCBI-ProteinID: XP_001841167
UniProt: A8PG81
Position
2
AA seq 457 aa AA seqDB search
MSSETSLQGAPRDAESGNIEKGSATPQILDSAAPTLNAVGDDVQQKDLAETGDQAENPKD
DEDSYPDGGLQAWLVVVGGMCTTFSTFGYVNSWGIFQGYYQETVLKDEPTSAIAWIGSIQ
YALIFVPGLVIGRLFDLGYFKSIFTFFSIILVGSTFLIPLCTKYWHFLLCQGFAVGLACG
CLFGPTPAIIAHWFKKRRGISMGIMAVGSSIGGTVMPIAARSLLPTVGFAWTMRIFGFIF
LGTMGLANVLLRRRLPPRNVPGGLFNWAVFKSAAFSVYCVSGLVTYLGVYTSRLNRSSPM
HSTLTSIIVLTYVSVSATRIGISNDFSFYFVAIANASSLFGRYTAGYLCDIIGPMNVMIP
FTAAAGILTYAWPFAQSKGSLIAVTILYGFASGTYVSLLTNPIFELGGTGDVGRRVGMFT
NILAIGAVAGPPISGAILTASGGFKMVGYYAGKFLLL
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccgaaactagtctccagggcgctccgagagatgctgaaagcggaaacatcgaa
aagggctcagctacacctcagatccttgactcggcggcaccgacgctcaacgctgtaggc
gatgacgtgcaacagaaagatctcgcagagaccggggaccaagccgagaatccgaaggac
gatgaagacagctatcccgacggaggtcttcaagcatggctagttgttgttgggggaatg
tgtacgacgttctcgacgttcggctatgtcaattcgtggggtatcttccagggatattat
caagagactgtcttgaaagatgagccaacatccgcgattgcgtggataggctcgattcag
tatgccctcatcttcgtaccgggtttggtcattggaagattattcgacctcgggtacttc
aaaagtatcttcaccttctttagcatcatcctcgtcggatcgaccttcctcatcccccta
tgcacaaagtactggcactttctcctatgtcaagggttcgcagtcgggcttgcgtgtggt
tgtctgttcggaccgacgcctgcgattatagcgcattggtttaagaaacggcgcgggatt
tcgatgggtattatggcggtgggctcgtcgataggtggaactgttatgcctattgccgca
cggagtctgctcccaaccgtaggcttcgcttggacaatgcggattttcggattcatattc
ctcggaacgatgggactggccaacgtgctactcagaaggaggcttcctccacggaacgtc
ccaggaggactgttcaattgggcagttttcaagtcggccgcgttctctgtttactgcgtg
tctggccttgtcacgtacttgggcgtttataccagtaggctcaaccgctcttccccaatg
cattcgacgctaacctcaataatagtgctgacctatgtcagcgtaagcgccacaagaata
ggaatctcgaacgacttctcattctattttgtcgccattgccaacgctagttctttgttc
ggtcggtatacggctggatacctctgcgacattatcggcccgatgaacgtgatgatcccg
ttcaccgctgcagctgggatccttacttatgcatggccctttgctcaatccaaaggctcg
ctgatagcagtgacgattctttacggatttgcttcaggaacctacgtctccctcctcacc
aaccctatttttgaactcggtggaacaggagacgtcggtcgacgagttgggatgttcacg
aacatccttgcgattggagcggtcgcgggccccccgatttctggtgccatcctgactgcg
tcggggggatttaaaatggtggggtactatgccggtaagtttttattactttga

DBGET integrated database retrieval system