KEGG   Coprinopsis cinerea: CC1G_10270Help
Entry
CC1G_10270        CDS       T01275                                 

Definition
(RefSeq) septin AspB
  KO
K16944  septin 7
Organism
cci  Coprinopsis cinerea
Brite
KEGG Orthology (KO) [BR:cci00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cci04131]
    CC1G_10270
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cci04812]
    CC1G_10270
   04147 Exosome [BR:cci04147]
    CC1G_10270
Membrane trafficking [BR:cci04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    CC1G_10270
Cytoskeleton proteins [BR:cci04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     CC1G_10270
Exosome [BR:cci04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CC1G_10270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 GTP_EFTU AAA_22 RsgA_GTPase AAA_16 AIG1 Ras ABC_tran AAA_29 Roc AAA_24 Exonuc_VII_L Atg14
Motif
Other DBs
NCBI-GeneID: 6005024
NCBI-ProteinID: XP_001828599
UniProt: A8N149
Position
1
AA seq 441 aa AA seqDB search
MAESFTSRSTDASGNGYANASNPSLVPTTQSQPSNIIRKKLMGYVGFANLPNQVHRKSVR
KGFQFTCMVVGESGLGKSTLVNTLFNTTLYPPKEPLPPSAERPKTVAIESIGADIEENGV
RLHLTVVDTPGFGDFVNNDDSWKPIVENIESRFDSYLEQENRVNRAKIVDNRVHACLYFI
QPTGHSLKQIDIEFMRRLHTKVNLIPVIAKADTLTDEEVAEFKQRILADIAHHNIHIFQA
PTYENEDEETLAEAEEIASKIPFAVVGSNQIVTTPDGREVRGRVYPWGVVEVDNEDHCDF
VKLRQMLVRTYMEELREYTNDVLYENWRTEKLLSMGVAQDSSVFKEINPAARLQEERILH
EAKLAKMEAEMKMVFQQKVQEKESKLKQSEEELYARHKEMKDALEKQRAELEDKKRRLET
GRPLTPEKSSATGRKKGFLRT
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggcagagtctttcacgtcccgttccacagacgcctcaggaaacggttatgccaatgct
tcaaatccgtctctagtgccaacaacgcaatcccagccctcaaacattatccgcaaaaag
ctcatgggctatgtcggctttgccaacctccccaaccaggtccataggaagagcgtcagg
aagggtttccagttcacttgcatggtcgtcggtgaatccggcctcggcaagtctaccctt
gtgaacacgctctttaacaccaccctctatccgcccaaggagcccctcccgccctcagcg
gagcggcccaagaccgttgccattgagagcattggcgctgacatcgaggagaacggcgtc
agactccatttgaccgtcgtcgacacccccggctttggtgactttgttaacaatgatgac
agctggaagcccatcgtggagaacatcgagtcccgcttcgattcctacctcgagcaagag
aaccgtgtcaaccgggccaagattgttgacaaccgtgtccatgcctgcctctactttatc
caacccaccggtcactcgttgaagcagatcgatatcgagtttatgcgcagattgcacacc
aaagtcaaccttattcccgtcatcgccaaggcagacaccttgactgacgaagaagtcgca
gagttcaagcagagaattctcgcggatattgcccaccacaacattcacatcttccaagcc
cctacctacgagaacgaagatgaagagacccttgcagaggctgaggagatcgccagcaag
attccattcgccgttgttggttcgaatcagattgtcactactcctgacggtcgtgaagtc
cgtggacgtgtgtacccctggggtgttgttgaggtcgacaacgaggaccactgtgatttc
gtcaagctccgccagatgcttgtccgaacttacatggaggaactccgagagtacaccaac
gatgtactctacgagaactggcgaacagagaagctcttgagcatgggtgtggctcaggac
tcgtcggtcttcaaggagatcaaccctgctgctcgtctccaggaagagcgcatcctgcac
gaagccaaacttgccaagatggaggccgagatgaagatggtgttccagcaaaaggtgcaa
gaaaaggagtccaagctcaagcaatccgaagaggagctgtatgctcgtcacaaggagatg
aaggatgcattggagaagcagcgcgccgagctcgaggacaagaagaggaggctcgagact
ggacgacccctgacaccagagaagtcctctgctactggccgaaagaagggtttccttcgt
acgtga

DBGET integrated database retrieval system