KEGG   Coprinopsis cinerea: CC1G_10272Help
Entry
CC1G_10272        CDS       T01275                                 

Definition
(RefSeq) succinate-CoA ligase
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
cci  Coprinopsis cinerea
Pathway
cci00020  Citrate cycle (TCA cycle)
cci00640  Propanoate metabolism
cci01100  Metabolic pathways
cci01110  Biosynthesis of secondary metabolites
cci01130  Biosynthesis of antibiotics
cci01200  Carbon metabolism
Module
cci_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cci_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CC1G_10272
   00640 Propanoate metabolism
    CC1G_10272
Enzymes [BR:cci01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     CC1G_10272
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CC1G_10272
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2 GFO_IDH_MocA
Motif
Other DBs
NCBI-GeneID: 6005026
NCBI-ProteinID: XP_001828601
UniProt: A8N151
Position
1
AA seq 331 aa AA seqDB search
MFRQAGQSVLSRAGRRAFSSSASRKSYDDTIRNLLIHKDTKVLCQGLTGKTGTFHVREAL
AYGTKMVGGVSPNKAGQTHLGLPIFGSVREAVKETQPDATVLYVPPPTAADAIIEAIENE
ISLIVCITEGIPQADEIRVMNALKSQSKSRLVGPNCPGIINPLGCKMGIQPGHIHKPGKI
GIVSRSGTLTYEAVAQTTDVGLGQSLCVGIGGDPFPGTQHVDVIKVFLEDPNTEGIVIIG
EIGGTMEEEAAEYLAQYNKTSANPKPVVGFIAGRTAPPGRRMGHAGAIISGGKGAAIDKV
KALEAAGVIVTDSPAKIGSEMLKAMQAAGLA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgttccgtcaagcagggcagtcggttctgtcgcgcgctggacgcagggcgttctcttca
tccgcgtcacggaagagctatgacgatacaatacgcaacctcttgatccacaaggacaca
aaagtcttgtgtcaaggcttgactggcaagactggtactttccatgtccgtgaagcgctg
gcgtatggaacgaagatggttggaggcgtctcgcctaacaaggctgggcagactcacctc
ggtttgcctatctttgggtctgttcgtgaagcagtgaaagaaacccaacccgatgcaacc
gtcctctacgtccctccacccactgccgcagacgccatcatcgaagctatcgagaacgaa
atctccctcattgtgtgtataaccgagggtattcctcaagccgacgagattcgggttatg
aacgctttgaagagccagtccaagtcgcgtcttgtcgggcccaactgtcccggaatcatc
aacccactcggctgcaagatgggcattcaacccggtcacatccacaaaccaggcaaaatc
ggcattgtctcccggtccggtacactaacctatgaagccgttgctcaaaccaccgacgtc
ggcctgggtcagtcgttatgtgttggaattggtggtgacccattccctggaactcagcat
gtggatgtgatcaaggtgttccttgaggatcccaacactgagggtattgttatcattggt
gaaattggcggcacgatggaggaggaagccgccgagtacctcgctcagtataacaagacc
agcgccaaccccaaacccgttgttggcttcattgcaggccgcaccgctccccccggaagg
cgtatgggacacgctggtgctattatttctggtggaaagggtgctgccatcgataaagtc
aaggcattggaagctgcaggtgtcatcgtcaccgacagccccgccaagatcggttcagag
atgttgaaggcaatgcaagcggccggtttggcatga

DBGET integrated database retrieval system