KEGG   Coprinopsis cinerea: CC1G_10735Help
Entry
CC1G_10735        CDS       T01275                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
cci  Coprinopsis cinerea
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 6015085
NCBI-ProteinID: XP_001838493
UniProt: A8P386
Position
4
AA seq 108 aa AA seqDB search
MPFAPGDASKGASLFKTRCAQCHTLGNGEPHKVGPNLFGIFGRKSGTGEGYSYTAANINK
GVTWTEETMWEYLENPKKYIPGTKMAFAGLKKEKDRNDLVTYLKEATS
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgcctttcgctcctggtgacgcttctaagggtgcttccctcttcaagacccgctgcgct
cagtgccacactctcggcaacggcgagcctcacaaggtcggccccaacctcttcggcatc
ttcggccgcaagtctggtaccggtgagggctactcctacaccgctgccaacatcaacaag
ggcgtgacatggacggaggagaccatgtgggagtaccttgagaaccccaagaagtacatt
cctggcaccaagatggccttcgctggtctcaagaaggagaaggacaggaacgacctcgtt
acctacctcaaggaggctacttcataa

DBGET integrated database retrieval system