KEGG   Coprinopsis cinerea: CC1G_10937
Entry
CC1G_10937        CDS       T01275                                 

Definition
(RefSeq) C-14 sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
cci  Coprinopsis cinerea
Pathway
cci00100  Steroid biosynthesis
cci01100  Metabolic pathways
cci01110  Biosynthesis of secondary metabolites
Module
cci_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:cci00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    CC1G_10937
Enzymes [BR:cci01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     CC1G_10937
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 6012696
NCBI-ProteinID: XP_001836156
UniProt: A8NT48
Position
4
AA seq 443 aa
MASKDNAVLNPKTTSYEFLGPPGATLVSIGVPFMLYALYFGCNETSGGCPPPLATVPERV
VAAVSDIEFWKSLYDQEAALIYAAWYAFCVGSWAILPGDWIEGTTLRTGEKKKYKINAFS
TFLLAMGITTGWILRNGPESFTFIYTKWVGFVTAALINSFIQAVFVYVMSFRPGRLLALG
GNSGNFIYDWFIGRELNPSIGSFDIKSFNELRPGLILWVLINISMVCEQAVRRGGFHNVT
DSMWLVLAFETWYVADALYNEPAVFTTMDIVSDGFGFMLSVGDLAWVPFVYTIQARYLAF
HPIELGIPATIAIILTNLLGYYIFRDSNGEKNDFRNGKNPKTRNDDAWIDLKWMPTKRGT
KLLISGWWGLCQHPNYLGDLIMALAWSLPTGFNTPVTYFYPIYFTILLLHRQNRDDEACH
AKYGDDWLEYKKKVPYKIFPYIY
NT seq 1332 nt   +upstreamnt  +downstreamnt
atggcctcaaaggacaacgcagtcctcaacccaaaaacaacctcttatgagttcttggga
ccaccgggggcaaccctggtcagtatcggcgtcccatttatgctctacgccctctacttt
ggctgcaacgaaacttcaggaggttgcccaccgccccttgccaccgtccctgaacgcgtc
gtcgccgccgtttccgacatcgagttctggaagagtctctatgaccaggaagcagcgctc
atctacgccgcttggtacgcgttctgcgtcggatcctgggccattctccctggcgactgg
atagaaggaaccaccctcagaactggtgaaaagaaaaagtataaaatcaatgccttttca
accttcttgttggcaatgggtatcaccactggctggatcttgcgcaacggccccgaatcc
ttcaccttcatctacaccaaatgggttgggtttgtcaccgccgccttgatcaactccttc
atccaggccgtctttgtctatgtcatgtctttccgcccgggacggctcctcgcccttggt
ggaaactcgggcaactttatctatgactggttcattggacgcgaactcaacccctccatc
ggctctttcgacatcaagtccttcaatgagctccgacctggccttatcctatgggttctc
atcaacatcagcatggtctgcgagcaggcggtcaggaggggaggcttccataatgtcacc
gattccatgtggttggttctcgcctttgagacctggtatgttgccgatgcgctctacaac
gagccggcggtcttcacaaccatggacatcgtcagcgacggcttcggattcatgttgtcc
gttggtgacttggcctgggttccgttcgtctataccattcaagcccgatacctcgccttc
caccctattgaactcggtatccccgcaaccatcgccatcatccttaccaacctccttggt
tactacatctttagagactccaacggcgagaagaacgatttcaggaacggaaagaacccc
aagactcgaaatgacgatgcttggatagacttgaaatggatgcctacgaagcgcggaacc
aagttgttgatttctggatggtggggactctgccagcatcccaactacctcggtgacctc
atcatggccctcgcatggagtctgcccacaggcttcaacactcccgtcacctacttctac
cccatctacttcaccattctcctcctccaccgacaaaatcgggacgatgaggcttgccat
gccaaatacggcgatgactggctcgagtacaagaaaaaggtcccttacaagatcttccct
tacatttactaa

DBGET integrated database retrieval system