KEGG   Coprinopsis cinerea: CC1G_12409Help
Entry
CC1G_12409        CDS       T01275                                 

Definition
(RefSeq) cellobiohydrolase I-I
  KO
K01225  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
cci  Coprinopsis cinerea
Pathway
cci00500  Starch and sucrose metabolism
cci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CC1G_12409
Enzymes [BR:cci01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     CC1G_12409
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_7
Motif
Other DBs
NCBI-GeneID: 6012925
NCBI-ProteinID: XP_001836368
UniProt: A8NU35
Position
4
AA seq 460 aa AA seqDB search
MFKKVALTALCFLAVAQAQQVGREVAENHPRLPWQRCTRNGGCQTVSNGQVVLDANWRWL
HVTDGYTNCYTGNSWNSTVCSDPTTCAQRCALEGANYQQTYGITTNGDALTIKFLTRSQQ
TNVGARVYLMENENRYQMFNLLNKEFTFDVDVSKVPCGINGALYFIQMDADGGMSKQPNN
RAGAKYGTGYCDSQCPRDIKFIDGVANSADWTPSETDPNAGRGRYGICCAEMDIWEANSI
SNAYTPHPCRTQNDGGYQRCEGRDCNQPRYEGLCDPDGCDYNPFRMGNKDFYGPGKTVDT
NRKMTVVTQFITHDNTDTGTLVDIRRLYVQDGRVIANPPTNFPGLMPAHDSITEQFCTDQ
KNLFGDYSSFARDGGLAHMGRSLAKGHVLALSIWNDHGAHMLWLDSNYPTDADPNKPGIA
RGTCPTTGGTPRETEQNHPDAQVIFSNIKFGDIGSTFSGY
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagaaagtcgccctcaccgctctctgcttcctcgccgtcgcacaggcccaacag
gtcggtcgcgaagtcgctgaaaaccacccccgtctcccgtggcagcgttgcactcgcaac
ggcggatgccagactgtctccaacggtcaggtcgtcctcgacgccaactggcgatggctc
cacgtcaccgacggctacaccaactgctacaccggtaactcctggaacagcaccgtctgc
tccgaccccaccacctgcgctcagcgatgcgctctcgagggtgccaactaccagcaaacc
tacggtatcaccaccaacggagacgccctcaccatcaagttcctcacccgatcccaacaa
accaacgtcggtgctcgtgtctacctcatggagaacgagaaccgataccagatgttcaac
ctcctcaacaaggagttcaccttcgacgttgacgtctccaaggttccttgcggtatcaac
ggtgccctctacttcatccagatggacgccgatggtggtatgagcaagcaacccaacaac
agggctggtgctaagtacggtaccggctactgcgactctcagtgcccccgtgacatcaag
ttcattgacggcgtggccaacagcgccgactggactccatccgagaccgatcccaatgcc
ggaaggggtcgctacggcatttgctgcgccgagatggatatctgggaggccaactccatc
tccaatgcctacaccccccacccttgccgaacccagaacgatggtggctaccagcgctgc
gagggccgcgactgcaaccagcctcgctatgagggtctttgcgatcctgatggctgtgac
tacaaccccttccgcatgggtaacaaggacttctacggacccggaaagaccgtcgacacc
aacaggaagatgaccgtcgtcacccaattcatcacccacgacaacaccgacactggcacc
ctcgttgacatccgccgcctctacgttcaagacggccgtgtcattgccaaccctcccacc
aacttccccggtctcatgcccgcccacgactccatcaccgagcagttctgcactgaccag
aagaacctcttcggcgactacagcagcttcgctcgtgacggtggtctcgctcacatgggt
cgctccctcgccaagggtcacgtcctcgctctctccatctggaacgaccacggtgcccac
atgttgtggctcgactccaactaccccaccgacgctgaccccaacaagcccggtattgct
cgtggtacctgcccgaccactggtggcaccccccgtgaaaccgaacaaaaccaccctgat
gcccaggtcatcttctccaacattaaattcggtgacatcggctcgactttctctggttac
taa

DBGET integrated database retrieval system