KEGG   Corynebacterium camporealensis: UL81_04005Help
Entry
UL81_04005        CDS       T03923                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ccj  Corynebacterium camporealensis
Pathway
ccj00071  Fatty acid degradation
ccj00280  Valine, leucine and isoleucine degradation
ccj00310  Lysine degradation
ccj00362  Benzoate degradation
ccj00380  Tryptophan metabolism
ccj00620  Pyruvate metabolism
ccj00630  Glyoxylate and dicarboxylate metabolism
ccj00640  Propanoate metabolism
ccj00650  Butanoate metabolism
ccj00900  Terpenoid backbone biosynthesis
ccj01100  Metabolic pathways
ccj01110  Biosynthesis of secondary metabolites
ccj01120  Microbial metabolism in diverse environments
ccj01130  Biosynthesis of antibiotics
ccj01200  Carbon metabolism
ccj01212  Fatty acid metabolism
ccj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ccj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    UL81_04005
   00630 Glyoxylate and dicarboxylate metabolism
    UL81_04005
   00640 Propanoate metabolism
    UL81_04005
   00650 Butanoate metabolism
    UL81_04005
  09103 Lipid metabolism
   00071 Fatty acid degradation
    UL81_04005
   00072 Synthesis and degradation of ketone bodies
    UL81_04005
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    UL81_04005
   00310 Lysine degradation
    UL81_04005
   00380 Tryptophan metabolism
    UL81_04005
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    UL81_04005
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    UL81_04005
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    UL81_04005
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccj04147]
    UL81_04005
Enzymes [BR:ccj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     UL81_04005
Exosome [BR:ccj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   UL81_04005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AKE38776
UniProt: A0A0F6TAQ4
Position
833357..834550
Genome map
AA seq 397 aa AA seqDB search
MTKPQPTDVVVVGAARTPFTKFRGALSSLTAPQLASHAIRAALEQGSVPAEAVDAVHLGQ
VLSAGVGQNPAKQAALGAGISPNAHTSSVNKVCLSGLTAIIDSARLLRSGEARVVVAGGM
ESMSQAPHLIRNTRTGTKYGELSTADHIEYDGLRAADTGISMGELTEKDADRYPATREEQ
DRCAALSHQRAKRAHSTEWFAKEVAPVTVETRRSTTVVDSDEGVRDNVTEESLSDLRPVF
AKEGTITAGNSSPLSDGAAAVVLCTAETAEEEGWTPLATLRAVGQVAGPDSSLQAQPANA
LQAALDRQGWLAEDLDHIEINEAFAAVVVHSAHVLGVEVDEVNPQGGAIAIGHPIGASGA
RLVVHAVHQLAKANIERAGVGLCGGGGQGEAILLEAE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagcctcaacccaccgatgttgtggtcgttggtgctgctagaacgccctttacc
aagtttcgtggtgcgttatcttccttgaccgcgccgcaactggctagccacgcgattaga
gctgctttagagcagggaagtgtccccgcagaagccgtagatgcagtgcatctgggccag
gtgctttctgccggagtgggtcaaaacccggcgaagcaggcagccttaggcgcaggcatt
agccccaatgcgcatacttcgagtgtgaacaaagtgtgcctgtctggtctcaccgcgatt
atcgacagcgcacgcctgttgcgctcgggtgaagcccgcgtcgtcgtcgccggtggcatg
gagtcgatgagccaggcaccgcacctgattcgcaacacgcgtaccggcactaagtacggt
gagttgtctaccgcggaccacatcgaatacgacggtctgcgcgcagctgatactggcatc
tccatgggtgagctcaccgaaaaggatgccgaccgttatcccgcgacccgcgaggaacaa
gaccgctgcgcagcgctttctcatcagcgcgctaagcgcgcacacagtacggagtggttc
gcgaaggaagtcgcacctgtcaccgtagagacccgccggtcgaccacggtcgtagattcc
gatgaaggcgtacgcgacaacgtcaccgaggagtccttgtccgacctgcgtccagtcttt
gccaaagaaggcacgattaccgcaggcaattcctcgccactgtcggatggtgctgcggct
gttgtcctgtgtactgcggaaaccgcggaagaagaaggctggaccccgctggcgaccctg
cgcgctgtcggtcaggtcgccggtcctgattcctcactgcaggcacagcccgctaatgcc
ctgcaagcagcgctggaccgccaaggttggctggctgaggacctcgaccacatcgaaatc
aatgaggctttcgctgccgtcgtcgtgcactctgctcacgtgctcggtgtggaagtcgat
gaggtcaacccacagggtggtgccatcgctattggtcacccgattggtgcttctggtgca
cgactggtcgtgcatgcagtccaccagctggcaaaggccaacattgaacgcgctggagtc
ggcctgtgcggcggtggcggccaaggcgaagcaatcttattggaggcagaataa

DBGET integrated database retrieval system