KEGG   Corynebacterium camporealensis: UL81_04570Help
Entry
UL81_04570        CDS       T03923                                 

Definition
(GenBank) hypothetical protein
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
ccj  Corynebacterium camporealensis
Brite
KEGG Orthology (KO) [BR:ccj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ccj03009]
    UL81_04570
Enzymes [BR:ccj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     UL81_04570
Ribosome biogenesis [BR:ccj03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    UL81_04570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_12 Methyltransf_23 Methyltransf_31 Methyltransf_32 Ubie_methyltran
Motif
Other DBs
NCBI-ProteinID: AKE38887
UniProt: A0A0F6QVL4
Position
946421..947275
Genome map
AA seq 284 aa AA seqDB search
MLSHIIDVLADPNDGTLLHGEDDFRRLVSESGRSYDVAKQGYVTLPVGAGLKHKGDDMDM
VNARETYLSMGHFAPFVEAVTSAIQDVVADVDADPTLLEVGAGTGYYLAHTLDSIEDSRG
IGLDISPHAAKHLAKSHSRVGAIVADVWERLPLRDDSVHAISVVFAPRNPAEFRRILAPG
GEVVVLTPDVGHLDELREPLGILGVEEGKVDRMYEQAEGYLEQAAEPEEITFPILLDKAS
IAAQVGMSPSARHISAEELNERMSKLPETVQVTAKARLDRLRAV
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgctttctcacattattgatgttctggccgatcccaacgacggaacgctactgcacggc
gaggacgattttcgtcgcctcgtttccgaatcgggacgcagctatgacgtagccaaacag
ggttacgttactttgccggtaggagccggactcaagcacaaaggcgatgacatggacatg
gtcaacgcccgtgagacttacctttctatgggccatttcgcgcccttcgttgaagccgtg
accagcgctattcaggatgtcgtcgctgacgttgacgcagacccgaccctcctggaagtc
ggcgccggtaccggctattaccttgcccataccctggactccatcgaagattcccggggt
atcggcttagacatttctccgcacgcggccaagcacctggctaagagccattcccgcgtt
ggcgcgatcgtcgctgacgtctgggagcgcctgccgcttcgcgatgactccgtccacgcc
atctccgtcgtcttcgccccgcgcaaccctgcggaattccgtcgtattctcgcccccggc
ggcgaggtcgtcgtcttgactccagacgttggtcacctcgatgagctgcgcgaaccgctc
ggcatcttaggcgtcgaagaaggcaaggtcgatcgcatgtacgagcaggccgaaggctac
ctcgagcaagccgccgagcccgaagaaatcactttcccgattctgctcgacaaagcttcc
attgccgcccaggtcggaatgagcccgtccgctcgccacatctccgctgaagagctcaac
gagcgcatgtccaaacttcccgagaccgtccaggtcaccgccaaggctcgtctggatcgt
ctccgcgccgtttaa

DBGET integrated database retrieval system