KEGG   Corynebacterium camporealensis: UL81_04620Help
Entry
UL81_04620        CDS       T03923                                 

Gene name
odhA
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E1 component
  KO
K01616  2-oxoglutarate decarboxylase [EC:4.1.1.71]
Organism
ccj  Corynebacterium camporealensis
Brite
KEGG Orthology (KO) [BR:ccj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    UL81_04620 (odhA)
Enzymes [BR:ccj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.71  2-oxoglutarate decarboxylase
     UL81_04620 (odhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh 2-oxoacid_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AKE38897
UniProt: A0A0F6QVL9
Position
complement(956443..960162)
Genome map
AA seq 1239 aa AA seqDB search
MSTPKIFGPNAWLIDEQFQQYSKDPSSVDKEWREFFEANGAPQSDAAKKGQDSAAAVKQS
EGSPAEVKQDVRETTVSQSAVKAREATQKAKPSKRKKPESPLDKIGEAPEAGEKQLKGMF
KAIAKNMEQSLEIPTATTVRDMPVKLMWENRTMINDHLKRTRGGKISFTHIIGYALVKAV
QLHPDMNVRYEVINDKPHVVQPEHINVGLAIDLPQKNGDRALVVAAIKECENKTFAEFVE
AYEDIVARSRKNKLTMDDFSGVTINLTNPGGIGTRHSIARLTKGAGSIIGVGSMDFPAEF
AGTSADRLADMGVGRLVTMTSTYDHRVIQGAESGDFLRTMSQLLIDDKFWDELFESMEVP
YSPYRWAQDVPNSGIDKNTRVMQFIEAYRSRGHLLANINPLGWKQPGLPWPDHRDLDMAT
HGLTIWDLDRVFNVGGFGGKEQMTLREVIGRLRSAYTLKVGSEYTHILDRDERSWLQDRL
EAGMPKPTNAEQKYILQKVNAAEAFENFLQTKYVGQKRFSLEGAESLIPLMDSIIDTAAG
QGLDEVVIGMPHRGRLNVLFNIVGKPLSDLFSEFDGNFKGGQLGGSGDVKYHLGSEGEHI
QMFGDGDIKITLTANPSHLEAVNPVMEGIARAKQDILEKTPEEYSVVPIQLHGDASFAGL
GVVQETINLSQLKGYKTGGTVHIVVNNQVGFTTTPDSARSTYYATDLAKGFDCPVFHVNG
DDPEAVFWVGQLATEYRREFGKDVFIDLVCYRLRGHNEADDPSMTQPRMYSLIDSHKGVR
ERYTEELVGRGDLSAEDAEAAARDFHDQMESVFTEHKEAEKAGPSEQTGITSSQELTRGL
DTSITADEIAEIGEAYANGPEGFEFHKRVAKVAKERLKSSKEGGIDWGWGELIAFGSLAN
EGTVVRLAGEDSRRGTFTQRHAIPIDPASGTEYNPLNSLAAEKGNGGKFMVYNSALTEFA
GMGFEYGYSVGNQDALVAWEAQFGDFANGAQTIIDEYVASGEAKWGQLSRLVLLLPHGYE
GQGPDHSSARIERYLQLCAEGSMTVAQPSTPANHFHLLRRQAMGEMKRPLVVFTPKSMLR
NKAAYSSIEEFTEVKKFRSVINDPYFFDANDKPADGDPEKVKTIMLVSGKLYYDLAKKRV
SDKRDDVAIVRVEMLHPIPFNRLREAFEAYPNAEQVRFVQDEPANQGPWPFYNEHLRDLI
PDMPEMVRISRRSQSSTATGIAKVHQLEQKKLLEEAFDC
NT seq 3720 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaccccgaagatcttcggccccaacgcgtggctgatagatgagcagttccagcag
tactccaaagacccaagctccgttgacaaggagtggcgcgagttcttcgaagccaacggt
gccccgcaatccgacgctgccaagaagggccaggattcggctgccgctgtaaagcagtcc
gaaggctctcctgccgaggtgaagcaggacgttcgcgaaaccactgtcagccagtccgct
gtcaaggcccgcgaggccacccagaaggccaagccttccaagcgcaagaagccagaatcc
ccgctggataagatcggcgaggctccagaggctggcgaaaagcagctcaagggcatgttc
aaggctatcgctaagaacatggagcagtccctggaaatcccgactgcaaccaccgtgcgc
gatatgccggtgaagctgatgtgggaaaaccgcaccatgatcaacgaccacctcaagcgc
acccgcggtggcaagatctcctttacccacatcattggttacgccctggtcaaggctgta
cagctgcacccggacatgaacgtccgctacgaggtcatcaacgacaagccgcacgtcgtc
caacctgagcacatcaacgttggcctggctattgacctgccacagaagaacggcgaccgc
gccctggtggttgctgccatcaaggagtgcgagaacaagaccttcgctgagttcgtcgag
gcttacgaggacatcgttgctcgttcccgcaagaacaagctgacgatggatgacttctcc
ggcgtcaccatcaacctgaccaacccgggtggcattggtacccgccactccattgctcgc
ctgaccaagggcgctggttccatcatcggtgtcggctccatggacttcccggctgagttc
gctggtacctccgctgaccgcctggctgacatgggcgtcggccgcctggtcaccatgacc
tccacctacgaccaccgcgtcatccagggtgctgagtccggtgacttcctgcgcaccatg
tcgcagctgcttatcgatgacaagttctgggacgaactcttcgagtccatggaggttcct
tactccccgtaccgctgggctcaggacgtgccgaactccggcatcgacaagaacacccgc
gtcatgcagttcatcgaggcctaccgctcccgcggccacctgctggcgaacatcaacccg
ctgggttggaagcagccaggtctgccttggccggatcaccgcgacctggacatggctacc
cacggccttaccatctgggacctggaccgcgtattcaacgtcggtggtttcggtggcaag
gagcagatgaccctgcgtgaggtcatcggccgcctgcgttctgcttacaccctcaaggtt
ggttccgagtacacccacattctcgaccgcgacgagcgctcctggctgcaggaccgcctc
gaagccggtatgccgaagccgaccaacgctgagcagaagtacatcctgcagaaggtcaac
gccgcagaggcattcgagaacttcctgcagaccaagtacgtcggccagaagcgcttctcc
ctggagggtgctgagtccctgattccactgatggactccatcatcgacaccgctgccggc
cagggcctggacgaggtcgttattggtatgccgcaccgcggtcgcctgaacgtcctgttc
aacatcgtcggcaagccgctgtctgacctcttcagtgagttcgacggcaacttcaagggc
ggccagctgggtggctccggtgacgtgaagtaccacctcggctccgagggcgagcacatc
cagatgttcggcgatggcgacatcaagatcaccttgaccgccaacccgtctcacctcgag
gcagttaacccggtcatggaaggtattgcccgcgctaagcaggacattctggaaaagacc
ccggaagagtactccgtggttccgatccagctgcacggcgatgcatccttcgctggtctg
ggcgtggtccaggagaccatcaacctctcccagctcaagggctacaagaccggcggcact
gtccacatcgtggtcaacaaccaggtgggctttaccaccaccccggattccgctcgttcg
acctactacgccaccgacctggccaagggcttcgactgcccggtcttccacgtcaatggc
gatgacccagaggctgtcttctgggttggtcagctcgctaccgagtaccgccgtgagttc
ggcaaggacgtcttcatcgacctggtctgctaccgcctgcgcggccacaacgaggccgac
gatccgtccatgacccagccgcgtatgtactcgctgattgactcccacaagggtgtccgt
gagcgctacaccgaagagctggttggccgtggcgacctgtccgctgaggacgctgaggct
gcagcacgcgacttccacgaccagatggaatccgtgttcaccgagcacaaggaagccgaa
aaggctggtccttccgagcagaccggtatcacctcttcccaggagctcacccgtggtctg
gatacctccatcaccgctgatgagatcgccgagatcggtgaggcttacgccaacggtccg
gaaggcttcgagttccacaagcgcgtggccaaggttgccaaggagcgcctgaagtcctcc
aaggaaggcggcatcgactggggctggggcgagctcatcgccttcggttccctggccaac
gagggcaccgttgtccgtctggccggcgaggattcccgccgcggtaccttcacccagcgt
cacgccattccgatcgacccggcaagcggcaccgagtacaacccgctgaactccctggct
gctgaaaagggcaacggcggcaagttcatggtgtacaactccgctctgaccgagttcgcc
ggcatgggcttcgagtacggctactccgtcggtaaccaggacgccctggttgcttgggag
gcacagttcggtgacttcgccaacggtgctcagaccatcatcgacgagtacgttgcttcc
ggtgaggccaagtggggccagctctcccgcctcgtgctgctgctgccgcacggctacgag
ggccagggcccggaccactcctccgcccgcatcgagcgttacctgcagctgtgtgctgag
ggttccatgaccgtggctcagccttctaccccggctaaccacttccacctgctgcgtcgt
caggcaatgggtgaaatgaagcgtccactggtggtcttcaccccgaagtccatgctgcgt
aacaaggccgcttactcctccatcgaggaattcaccgaggtcaagaagttccgttcggtc
atcaacgacccgtacttcttcgatgccaacgacaagccggctgacggtgacccggagaag
gtcaagaccatcatgctggtctccggcaagctctactacgacctggctaagaagcgcgtt
tctgacaagcgtgacgacgtcgccatcgtccgcgtggagatgctgcacccgattccgttc
aaccgtctgcgtgaggccttcgaggcttacccgaacgccgagcaggttcgcttcgtccag
gacgagccggccaaccagggcccatggccgttctacaacgagcacctgcgcgacctgatt
ccggacatgccggaaatggttcgcatctctcgccgttcccagtcctcgactgcaaccggt
atcgccaaggtgcaccagctggagcagaagaagctgctggaagaagccttcgactgctaa

DBGET integrated database retrieval system