KEGG   Corynebacterium camporealensis: UL81_06265Help
Entry
UL81_06265        CDS       T03923                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
ccj  Corynebacterium camporealensis
Pathway
ccj00030  Pentose phosphate pathway
ccj00480  Glutathione metabolism
ccj01100  Metabolic pathways
ccj01110  Biosynthesis of secondary metabolites
ccj01120  Microbial metabolism in diverse environments
ccj01200  Carbon metabolism
Module
ccj_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ccj_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:ccj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    UL81_06265 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    UL81_06265 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccj04147]
    UL81_06265 (zwf)
Enzymes [BR:ccj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     UL81_06265 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     UL81_06265 (zwf)
Exosome [BR:ccj04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   UL81_06265 (zwf)
  Exosomal proteins of colorectal cancer cells
   UL81_06265 (zwf)
  Exosomal proteins of bladder cancer cells
   UL81_06265 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AKE39216
UniProt: A0A0F6TAM2
Position
1323282..1324814
Genome map
AA seq 510 aa AA seqDB search
MEQTSAWRNPLRNPKDKRLPRIAGPSGMVIFGVTGDLARKKLLPAIYDLANRGLLPAGFT
LVGYGRRDWDKAQFGEYVKEAVQQRARTKFNEHVWQHLAQGIEFVEGAFDDAGFDHLSAR
LQELDTARGTGGNWAYYLSVPPEFFSNICHQLERVGMAASDEEAWRRVIIEKPFGHDQKS
AHELNEIVNAVFPESSVFRIDHYLGKETVQNIMALRFANQIFEPMWNAHYIDHVQITMAE
DIGLGGRAGYYDGIGAARDVIQNHLLQLLALVAMEEPSSFEPAALQAEKIKVLRATHPMH
PLGKTTARGQYSAGWQGSQYVKGLREEEGFDPESTTETYAACTLEVNSRRWGGVPFYLRT
GKRLGRRVTEIALVFKAAPHQPLDGGQTDDLGQNAVVIRVQPDEGVTMRFGSKVPGSTME
VRDVNMDFAYAQAFNEESPEAYERLILDALLDESSLFPTNEEVELSWEILDPIIEYWAKS
GQPEKYAAGTWGPESADKMLRRRGHTWRRP
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaaccagcgcatggcgcaatccgttgcgcaacccgaaggacaagcgactcccg
cgaatcgcaggtccttcgggcatggtgatctttggtgtcaccggcgacctcgcccggaag
aaactgcttccggctatttacgatctcgctaaccgcggattgctgcctgctggttttacc
ctcgttggctacggccgccgtgactgggacaaagcccagttcggcgagtacgtcaaagag
gcagtccagcagcgcgcccgaaccaagttcaacgagcatgtctggcagcaccttgcccaa
ggcattgagttcgtcgaaggtgccttcgacgacgccggctttgatcacctctctgcccgc
ctgcaggaactcgatactgcacgcggtaccggtggcaactgggcttactacctgtctgtg
ccaccggagttcttctctaacatctgccaccagctcgagcgcgtcggcatggcagcaagt
gatgaagaagcctggcgccgtgtgatcatcgaaaagccttttggccacgaccagaagtcc
gcacacgagctcaacgagatcgtcaacgcggtcttcccggagtcttcggtctttcgtatc
gaccactacctgggcaaagagaccgtgcaaaacatcatggcgctgcgctttgccaaccag
atttttgagccgatgtggaacgcgcactacatcgaccacgtgcagatcaccatggccgaa
gatatcggcctgggcggtcgcgccggttactacgacggcattggcgctgcccgcgacgtt
atccagaaccacctgctgcagctactcgccctagtcgccatggaagagccatcttccttc
gaaccagcagcgctgcaggcagaaaagattaaggtcctgcgcgccacgcacccgatgcat
ccactgggcaagaccaccgcgcgtggccagtactctgctggctggcagggctctcaatac
gtcaagggcttgcgcgaggaagagggcttcgatcccgaatccaccacggaaacctacgcg
gcctgcactctcgaggtgaactctcgtcgttggggcggcgtgcctttctacctgcgtacc
ggcaagcgcctgggccgccgcgtgaccgagattgccctggtcttcaaagcggcaccgcac
cagcctctcgatggtggccagaccgatgatctcggccaaaatgccgttgttatccgcgtc
cagcccgatgaaggcgtgaccatgcgctttggttctaaggttccaggttccaccatggaa
gtccgcgacgtgaacatggacttcgcttatgcgcaggccttcaacgaagaatcccctgag
gcctatgagcgcctcattctcgatgcgttgctggatgagtcctcgctcttccccactaac
gaagaagttgagctgtcctgggaaatcctggacccgattattgagtactgggccaagagc
ggccagccggaaaaatacgccgctggtacttggggtcctgagtccgccgacaagatgctg
cgccgccggggccatacctggcgccgcccatag

DBGET integrated database retrieval system