KEGG   Corynebacterium camporealensis: UL81_06515Help
Entry
UL81_06515        CDS       T03923                                 

Definition
(GenBank) Phosphate transporter family
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
ccj  Corynebacterium camporealensis
Brite
KEGG Orthology (KO) [BR:ccj00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    UL81_06515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Gluconate_2-dh3
Motif
Other DBs
NCBI-ProteinID: AKE39266
UniProt: A0A0F6TAP5
Position
1378056..1379594
Genome map
AA seq 512 aa AA seqDB search
MGFGILTAATLVLFIFWGTDYIADGSSNIILITAIIFALFMAFNIGGNDVANSFGTSVGA
GTLSLKQALIVAAIFEVSGAVLAGGQVTDTVRSGIVDLEAIDGLDPMEFVYIMMSALLGA
AIWLLLATRMGWPVSTTHSIVGGIVGAALTVGFITNKGGWSMVQWSEIGTIAISWVLSPA
LGGLAAYLLFRWIKNSILVYNESADAHIRDIKTRRAELREEHKQSFQRLNEIQQISYTNA
MARDAALASEDDVEPDQFESDYYQELYELNKEMDDVDAHRALEHWVPLLAALGAIIISAM
MLFKGLSNIDVSFSTLQSVLVMGMVGAVVWMAVFIFAKTLKKHSLNRSTFLLFSWMQVFT
ASAFAFSHGSNDIANAIGPFIAILDVLKTGEISDEAEVPIAVMVAMGIALISGLWFVGRY
VIKTVGTNLTEIHPSSGFAAELAAAGVVMLASVLGLPVSSTHILIGAVLGVGIVNRAANW
KLMRPIAMAWVITLPASAGIAAVTVSILRVVL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgggctttggcattttgaccgctgcaacgctggtgctctttattttctggggcactgac
tacattgcggatggctccagcaacattattttgattacagccattatctttgcgctgttt
atggcgttcaatatcggcggcaacgacgttgcgaactcttttggtacctcagtcggtgca
ggcacgctctcgttgaaacaggcactgattgtcgccgccatttttgaggtctccggcgca
gtcctggctggcggtcaggtcaccgatacggtgcgctccggcatcgtggatttggaagcc
atcgatggcttggacccgatggagtttgtctacatcatgatgtcggccctactgggtgca
gctatctggctgttgctggcaacccgcatgggctggccagtctctactacccactcaatt
gtcggcggtatcgtcggtgcggcattgaccgtgggcttcattaccaacaagggcggctgg
tcgatggtccagtggtccgagattggcaccattgctatctcctgggtgctctcccctgcg
ctgggcggtctggctgcgtatctgctcttccgctggattaagaactccatcctggtctac
aacgagtccgccgatgcacacattcgcgacatcaagacccggcgcgccgagctgcgcgaa
gagcacaagcaaagcttccagcgtcttaatgagatccagcagatctcctataccaacgcg
atggcccgcgacgccgccttggcgtccgaagatgacgtcgaacctgatcaattcgagtcg
gattactaccaggagctctatgagctcaacaaagaaatggatgacgtggatgcccaccgc
gcacttgagcactgggtcccactgcttgccgcgttaggtgccatcatcatctcggcgatg
atgctctttaagggcttaagcaacatcgacgtcagcttctctaccctgcagtccgtactc
gtgatgggcatggtcggtgctgtggtgtggatggccgtattcatctttgccaagacctta
aagaagcattcgctgaaccgctcgaccttcttgctcttttcctggatgcaggtctttacc
gcttctgcattcgcgttctcccacggctccaatgacatcgcgaacgccattggtcctttc
atcgccatcctggacgtgctgaagactggtgagatttccgacgaagccgaagtcccgatt
gccgtcatggtcgccatgggcatcgccttgatttccggcctctggttcgtcggccgctac
gtcattaagactgtcggtaccaacctcaccgaaatccacccttcttccggcttcgccgct
gagctcgccgccgccggcgtggtcatgctggcttccgtcctcggcctgccagtctcctcc
acccacatcctcatcggtgccgtcttaggtgtcggcattgttaaccgcgctgctaactgg
aagctcatgcgacctatcgccatggcctgggtcatcaccctgcctgcttctgctggcatc
gccgcagtcaccgtctccatcctgcgcgtcgtgctctaa

DBGET integrated database retrieval system