KEGG   Corynebacterium camporealensis: UL81_09715Help
Entry
UL81_09715        CDS       T03923                                 

Gene name
acx
Definition
(GenBank) Acyl-coenzyme A oxidase
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
ccj  Corynebacterium camporealensis
Pathway
ccj00071  Fatty acid degradation
ccj00410  beta-Alanine metabolism
ccj00592  alpha-Linolenic acid metabolism
ccj00640  Propanoate metabolism
ccj01040  Biosynthesis of unsaturated fatty acids
ccj01100  Metabolic pathways
ccj01110  Biosynthesis of secondary metabolites
ccj01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ccj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    UL81_09715 (acx)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    UL81_09715 (acx)
   00592 alpha-Linolenic acid metabolism
    UL81_09715 (acx)
   01040 Biosynthesis of unsaturated fatty acids
    UL81_09715 (acx)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    UL81_09715 (acx)
Enzymes [BR:ccj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     UL81_09715 (acx)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_M Acyl-CoA_dh_1 ACOX Acyl-CoA_dh_N
Motif
Other DBs
NCBI-ProteinID: AKE39878
UniProt: A0A0F6QZL0
Position
2041637..2043742
Genome map
AA seq 701 aa AA seqDB search
MLLNKNKKENEFAPGVDGPDNSTPAEIRPDHAKAEPNSPARLPMKPDPAIVPELQALLEG
ENPEFRARMREFGENPDLYPRSDLPLEEQRRHTMEGVRAVGEEGYFLAGFREENGGSSNP
RDALTTLEALASINGSLAIKSGVQWGLWGGAVDQLGTERHSEWARKAASLEVPGCFAMTE
HGHGSDVQSLETVATYDVETQEFVIDTPRDSAVKNYIGNAAADGRAAAVFAQLVTPDSDG
RSNGVHCFIVPIRDEEGNALPGITIGDHGHKGGLVGVDNGTLAFDKVRIPRENLLNRFAD
VDEKGHYSSPIKSKNARFFTMLGTLIRGRIAVSGAAGGATQASLDIAVRYANRRRQFPGA
TGHEKKLIDYRSHRRRLLIPLARTYALQLLQNQILDRYHEQVQQQNSGAWSVTEPNEEQK
FASREMESLAAAIKSAQTAHANKTIQECREACGGAGYMSENRLTTYRADADVYATFEGDN
TVLIQMVGKNLLTAYGRDMSDMSPWDTVRYVAETAGDVVRRRTGFTTRLQGIRDLVTAEE
NHSLFEANYQAQLIDDRAQSVLKSLVRRVAPARSADKVQAAAIMNKVQDHLIAAGWARVD
TLLVQAMVEAEEKLEEGSQARKVFEQLRHLFVFDSIVQHAGWYQEHNMLPASRVKAARAA
INDLVDSLAPWSVVLVDAFGIPAEASNVPMLNSSGVDPKRD
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgttgctcaataagaataagaaggaaaacgagttcgcccctggtgtggacggccctgac
aactccactcctgcggagattcgcccggaccatgccaaggcagagcccaacagcccggcg
cgcctgccgatgaagccagacccggccatcgtgcctgagctgcaggctctcctggaaggt
gagaacccggagttccgcgcccgaatgcgcgagtttggtgagaaccctgacctctatccg
cgctcggatctgccgctggaggaacagcgccgccacaccatggaaggcgtgcgcgcggtc
ggagaggaaggctacttcctggctggcttccgcgaggaaaacggcggttcctccaacccg
cgcgatgcgctgaccacgctggaggcgctggcgtctatcaacggttcgctggctattaag
tccggcgtgcagtggggcctgtggggcggcgcagtggaccagctgggcaccgagcgccac
tccgagtgggcgcgcaaggcagcgagcctggaggtgccgggctgctttgcgatgaccgaa
cacggccacggctccgacgtccagtccctcgagaccgttgcgacctacgacgtggagacc
caggaattcgtcatcgataccccgcgtgattccgcggtgaagaactacatcggtaacgcc
gctgccgatggtcgcgcagcggccgtcttcgcgcagctggtcactccggattccgatggc
cgctccaacggcgtgcactgcttcatcgtcccaattcgcgacgaagagggcaacgccctg
ccaggtatcaccattggcgaccacggccacaagggtggcttggtcggtgtggataacggc
acccttgccttcgacaaggtccgcatcccacgtgagaacctgctcaaccgcttcgcggat
gtggacgagaagggccactactcctcgccgattaagagcaagaacgcccgcttcttcacc
atgctgggcaccctgattcgcggtcgcatcgcggtctccggtgctgcgggtggtgcaacg
caggcatcgctggatattgcggtgcgctatgccaaccgccgtcgtcagttcccgggcgct
actggtcatgaaaagaagctcattgactaccgctcgcaccgtcgtcgcctgctcatcccg
ctggcgcgcacctacgctctccagctgctgcagaaccagatcctggaccgctaccacgag
caggtgcagcagcagaacagcggcgcatggtcggtgaccgagccgaacgaggagcagaag
tttgcttcccgcgagatggagtcgctggccgcagcgattaagtccgcgcagaccgcgcat
gcgaataagaccattcaggagtgccgcgaggcctgcggcggtgctggttacatgagcgag
aaccgcctgaccacctaccgcgcagatgctgacgtgtatgccaccttcgaaggtgacaac
accgtgctcattcagatggtcggtaagaacctgctgactgcgtatggccgcgatatgtcg
gatatgtccccgtgggatacggtgcgctacgtggctgagaccgccggtgatgtcgtgcgt
cgccgcacgggcttcaccacccgcctgcagggcattcgcgacctggtgacggcggaggag
aatcactccctgtttgaggccaactaccaagcacagcttatcgatgaccgagcccagtcc
gtcctcaaatccttagtccgccgcgtcgccccggcgcgctctgcggacaaggtgcaggcc
gccgccatcatgaacaaggtccaggaccacctgattgctgctggttgggctcgcgtggac
accctgctggtccaggccatggtggaggccgaggagaagctggaagaaggctcgcaggca
cgcaaggtctttgagcagctgcgccacctgtttgtctttgacagcatcgtccagcatgca
ggctggtaccaggagcacaacatgcttccggccagccgcgtgaaggcagcgcgtgctgcg
attaatgacctggtcgactccctggcaccgtggtcggtcgtgctggtggatgccttcggc
attccggcagaggcctccaacgtgccgatgctcaacagctcgggcgtggacccgaagcgg
gactag

DBGET integrated database retrieval system