KEGG   Corynebacterium camporealensis: UL81_10295Help
Entry
UL81_10295        CDS       T03923                                 

Gene name
ackA
Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
ccj  Corynebacterium camporealensis
Pathway
ccj00430  Taurine and hypotaurine metabolism
ccj00620  Pyruvate metabolism
ccj00640  Propanoate metabolism
ccj00680  Methane metabolism
ccj01100  Metabolic pathways
ccj01120  Microbial metabolism in diverse environments
ccj01200  Carbon metabolism
Module
ccj_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:ccj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    UL81_10295 (ackA)
   00640 Propanoate metabolism
    UL81_10295 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    UL81_10295 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    UL81_10295 (ackA)
Enzymes [BR:ccj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     UL81_10295 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AKE39993
UniProt: A0A0F6QZR1
Position
complement(2162132..2163352)
Genome map
AA seq 406 aa AA seqDB search
MSYVLVLNSGSSSVKFQLVNPESTATDVPLVSGLVEQVGEPMGAVTVKTGGEEYTEELEI
PTHSFGLERAFAIMSEHNVGPTDVEVIAVGHRVVHGGRLFSEPQLITDEIEKMVEDLIPL
APLHNPANLDGIRVARELLPDIPHVGVFDTAFFNHMPPAAALYAINNEVASKYDIRRYGF
HGTSHEFVSQQVPKLLDRDPGETHQITLHLGNGASAAAISNGTPIDTSMGLTPLAGLAMG
TRSGDIDPGIIFHLSREAGMSIAEIDNLLNKQSGVKGLAGVNDFRILRERINDGDSDAWL
AYNIYIHQLRRFIGSYMIALGRVDAITFTAGVGENDTEVRQDSLYNLDMYGIDFDKEANL
VRSREPRMISTPESKVKVFVVPTNEELAIAQKSAEVAAAAKQAGLY
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgagctacgttctggttctgaactccggatcttcatccgttaagtttcagctggtcaac
cccgagtccaccgccaccgacgtaccactggtctccggcctggtcgagcaggtcggcgag
ccgatgggtgctgtcaccgtcaagaccggcggcgaggagtacaccgaggaactggagatc
ccaacccactccttcggactcgagcgcgcctttgccatcatgagcgagcacaacgtcggc
cccaccgacgttgaggtcatcgccgtcggccaccgcgtcgtccatggcggacgcctcttc
tccgagccgcagctcatcactgacgagatcgagaagatggtcgaggacctcatcccgctc
gcaccgctgcacaacccggcgaacctggacggcatccgcgtcgcccgcgagctcctgccg
gacatcccgcacgtcggcgtcttcgataccgccttcttcaaccacatgccgccggctgcc
gcactgtatgccatcaacaacgaggtggcctccaagtacgacatccgccgctacggcttc
cacggcacctcgcacgagttcgtttcccagcaggtcccgaagctgctcgaccgcgacccg
ggcgagacccaccagatcaccttgcacctgggcaacggtgcttctgccgccgctatctcc
aacggcaccccgatcgatacctccatgggtcttaccccgctggctggcttagcgatgggc
acccgctccggcgacatcgaccccggcatcatcttccacctttcccgcgaggcgggtatg
agcatcgccgaaatcgataacctgctcaacaagcagtccggtgtcaaaggtctcgctggc
gtcaacgacttccgcatcctgcgcgagcgcatcaacgacggcgactccgatgcctggctg
gcgtataacatctacatccaccagctgcgccgcttcatcggctcctacatgattgccctg
ggccgcgtcgacgccatcacctttaccgccggcgtgggcgaaaacgacaccgaggtccgc
caggattccctgtacaacctggacatgtacggcatcgacttcgacaaggaagccaacctg
gtccgttcccgcgaaccacgcatgatttccaccccggagtccaaggttaaggtcttcgtc
gtcccgaccaacgaggagctcgccatcgcgcagaagtccgccgaggtcgcagccgccgcc
aagcaggccgggttgtattag

DBGET integrated database retrieval system