KEGG   Corynebacterium camporealensis: UL81_10325Help
Entry
UL81_10325        CDS       T03923                                 

Gene name
purA
Definition
(GenBank) Adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
ccj  Corynebacterium camporealensis
Pathway
ccj00230  Purine metabolism
ccj00250  Alanine, aspartate and glutamate metabolism
ccj01100  Metabolic pathways
Module
ccj_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:ccj00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    UL81_10325 (purA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    UL81_10325 (purA)
Enzymes [BR:ccj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     UL81_10325 (purA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AKE39999
UniProt: A0A0F6TCE9
Position
complement(2170988..2172280)
Genome map
AA seq 430 aa AA seqDB search
MGAIVIVGAQWGDEGKGKATDILGGKVDYVVKPNGGNNAGHTVVVGGDKYELKLLPAGIL
SENATPVLGNGVVINLEALFEEIDGLEARGAQASRLRISANAHLVAPYHQTLDRVQERFL
GKRAIGTTGRGIGPAYADKVARIGIRVQDIFDESILRQKVESALDIKNQMLVKMYNRKAI
DPEQVVEYFLSYRERLAPMVIESEKELNEALDAGKNVLMEGGQATMLDVDHGTYPFVTSS
NPSAGGAAVGSGIGPTKITTSLGIIKAYTTRVGAGPFPTELFDKWGEYLQDTGGEVGVNT
GRKRRCGWYDSVIARYATRVNGFTDYFLTKLDVLTGIGEIPICVAYDVDGTRHDEMPMTQ
SDFHHAEPIFETMPAWDEDITGCQTFEDLPQKAQDYVLRLEELSGTRISYIGVGPGRDQT
IVRHDVMQDQ
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcaatcgttatcgtcggcgcgcagtggggcgacgaaggtaaaggcaaagccacc
gatattctcggcggtaaggtcgattacgtcgtaaagcccaacggcggtaacaacgctggc
cacaccgtggtcgtcggcggcgataagtacgagctgaagctgctgcccgccggaattttg
tctgaaaacgccaccccggtgctcggcaacggcgtagtgattaacctcgaggcactcttt
gaagaaattgatggtctcgaagcccgcggcgcacaggcatcccgcctgcgcatttctgcc
aacgctcacctggtggccccgtaccaccagaccctcgaccgcgtgcaggagcgtttcttg
ggcaagcgcgctattggtaccaccggccgcggtatcggcccggcttatgcggacaaggtt
gctcgtattggcatccgtgtccaggacatcttcgatgagtccattctgcgtcagaaggtc
gaatcggcactggatattaagaaccagatgttggtcaagatgtacaaccgcaaggcgatc
gacccggagcaggtcgtggagtacttcctgagctaccgtgagcgtctcgccccgatggtc
attgaatctgagaaggaacttaatgaggccctcgatgccggcaagaacgtgctcatggaa
ggcggccaggccaccatgctggatgtcgaccacggcacttacccattcgtgacctcgtcc
aacccttctgctggtggcgctgccgtcggttctggcattggtccgaccaaaatcaccacc
tccctgggcatcatcaaggcctacaccacccgtgtcggcgctggccctttccccacggag
ctgttcgacaagtggggcgagtacctgcaggacaccggcggtgaggttggcgtgaacacc
ggccgtaagcgtcgctgtggctggtacgactcggtcattgcccgctacgccacccgcgtc
aacggctttaccgactacttcctgaccaagctggacgtgctcaccggcatcggtgaaatc
ccgatctgcgtggcttacgatgtcgacggcacccgccacgacgaaatgcccatgacccag
tcggacttccaccacgctgagcccatcttcgaaaccatgccagcgtgggatgaagacatc
accggctgccagaccttcgaagacctgccacaaaaagcccaagactacgtcctgcgcctg
gaagaactctccggcacccgcatctcctacatcggcgttggccccggccgggaccagacc
attgtgcgccacgacgtgatgcaggatcagtaa

DBGET integrated database retrieval system