KEGG   Corynebacterium crudilactis: ccrud_02405Help
Entry
ccrud_02405       CDS       T04829                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
ccjz  Corynebacterium crudilactis
Brite
KEGG Orthology (KO) [BR:ccjz00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    ccrud_02405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 OST3_OST6
Motif
Other DBs
NCBI-ProteinID: ANE03175
UniProt: A0A172QR52
Position
complement(509973..511172)
Genome map
AA seq 399 aa AA seqDB search
MTELIILLIVILTALAFDFTNGFHDTGNAMATSIATGALKPKIAVALSAVLNLVGAFLSV
EVAATVAKGIVDLDQFDLSNAWDSHQLLLVVFAGLIGAIVWNLLTWLLGIPSSSSHALFG
GLIGAAIASLGFSGVVWEGVLAKMILPALAAPVVAGLVAAIGTFAVYSITKAVGDKEKNR
YFRWGQIGSASLVSLAHGTNDAQKTMGVIFLSLVATGHIGAEADIPFWVKATCALAIAVG
TYMGGWRVIRTLGKGLVEIDSPQGMAAETSSAAIILTSSHFGMALSTTHVATGSIMGTGI
GRKGASVRWSVAGRMAMAWLITLPASALVGVFCWWVAHGVGLFSSDLIGVLVAFAILLGL
SGYIFARSRRAPVDPSNVNADWDEDSNGVETNDANEVTK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgagctgattattttattgattgttatcttgacggcgcttgccttcgatttcaca
aatggattccacgacacaggaaatgcgatggctacatccatcgcaacaggagccctcaaa
ccaaaaattgcagtagctctatccgcagtcctcaacctggtaggtgcattcctttccgtt
gaagttgcggcaaccgtggcaaagggcatcgtcgacttagaccaattcgatctaagcaat
gcttgggattcccaccaacttctgctcgtagtcttcgccggcctcatcggcgcaatcgtg
tggaaccttctcacctggctgctgggcattccgtccagctcctcccacgcactattcggt
ggcctcatcggtgccgcaattgcttccctcggtttcagcggagtggtctgggaaggtgtc
cttgccaagatgatcctcccagcgctggcagcaccagttgtggctggactcgtggcagcc
atcggcacattcgcggtgtacagcatcaccaaagccgttggcgataaggaaaagaaccgc
tacttccgctggggccaaatcggttctgcctccctagtttccctggctcacggcaccaac
gatgcccaaaagaccatgggcgttatcttcctctctctggtagccacaggacatatcgga
gccgaagcagatatcccattctgggttaaagcaacctgtgctctagccattgcagttggt
acctacatgggtggctggcgcgttatccgtaccctcggaaaaggcttggtggagattgat
tcaccacagggcatggcagctgaaacctcttctgcagccatcatcttgacttcttcccac
ttcggtatggcactgtctacaactcacgtagctaccggctccatcatgggtaccggtatt
ggacgtaagggcgcttctgtgcgctggtcagtcgcaggtcgcatggcgatggcatggctc
atcactcttccagcttctgccctcgttggtgttttctgctggtgggttgcccacggcgta
ggtcttttcagctcagacctcatcggtgttcttgtcgcttttgctattctgctcggcctt
tccggctatatctttgcacgctctcgccgtgcgccagttgatccaagcaacgtcaatgct
gattgggatgaagactcaaacggtgttgagactaacgatgcaaatgaggtaaccaaataa

DBGET integrated database retrieval system