KEGG   Corynebacterium crudilactis: ccrud_02415Help
Entry
ccrud_02415       CDS       T04829                                 

Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
ccjz  Corynebacterium crudilactis
Pathway
ccjz00790  Folate biosynthesis
ccjz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccjz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ccrud_02415
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccjz04147]
    ccrud_02415
Enzymes [BR:ccjz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     ccrud_02415
Exosome [BR:ccjz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ccrud_02415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a IF-2 RPN7
Motif
Other DBs
NCBI-ProteinID: ANE03177
UniProt: A0A172QR54
Position
complement(512564..512845)
Genome map
AA seq 93 aa AA seqDB search
MNSLFDVSPRWTFANDQLNAHFATGDFATGVKFINRIAASAEEANHHPDLLLSYSFVEIT
LTSHDVGHVTERDISLARIIDAHADALQIKAEA
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atgaattcgcttttcgacgtctccccacgttggaccttcgccaacgatcaactcaatgca
cattttgccaccggcgattttgccaccggtgtgaaattcatcaaccgcatcgcagcttct
gccgaagaagctaaccaccaccccgatctcctgctgagttatagcttcgtggaaatcacc
ctgacaagccacgatgttgggcatgtcaccgaacgtgatatctccctagctcggatcatt
gatgcacacgctgacgcgctacagattaaagcagaggcttaa

DBGET integrated database retrieval system