KEGG   Corynebacterium crudilactis: ccrud_10645Help
Entry
ccrud_10645       CDS       T04829                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ccjz  Corynebacterium crudilactis
Pathway
ccjz00071  Fatty acid degradation
ccjz00072  Synthesis and degradation of ketone bodies
ccjz00280  Valine, leucine and isoleucine degradation
ccjz00310  Lysine degradation
ccjz00362  Benzoate degradation
ccjz00380  Tryptophan metabolism
ccjz00620  Pyruvate metabolism
ccjz00630  Glyoxylate and dicarboxylate metabolism
ccjz00640  Propanoate metabolism
ccjz00650  Butanoate metabolism
ccjz00900  Terpenoid backbone biosynthesis
ccjz01100  Metabolic pathways
ccjz01110  Biosynthesis of secondary metabolites
ccjz01120  Microbial metabolism in diverse environments
ccjz01130  Biosynthesis of antibiotics
ccjz01200  Carbon metabolism
ccjz01212  Fatty acid metabolism
ccjz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ccjz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ccrud_10645
   00630 Glyoxylate and dicarboxylate metabolism
    ccrud_10645
   00640 Propanoate metabolism
    ccrud_10645
   00650 Butanoate metabolism
    ccrud_10645
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ccrud_10645
   00072 Synthesis and degradation of ketone bodies
    ccrud_10645
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ccrud_10645
   00310 Lysine degradation
    ccrud_10645
   00380 Tryptophan metabolism
    ccrud_10645
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ccrud_10645
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ccrud_10645
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ccrud_10645
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccjz04147]
    ccrud_10645
Enzymes [BR:ccjz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ccrud_10645
Exosome [BR:ccjz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ccrud_10645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ANE04616
UniProt: A0A172QVD8
Position
2286043..2287269
Genome map
AA seq 408 aa AA seqDB search
MNPQDIVICSPLRTPVGAYGGSFTGIPVQDLATTVINAIVDATGITGSDVDDLILGQGSP
NGSAPALGRVVALDSKLGMEVPGMQLDRRCGSGLQAILTAASHIATGAADLIIAGGAESM
SRTEYTVSGDIRWGVKGGDMQMRDRLAEARETAGGRNHPIPGGMIETAENLRREYGISRE
EQDQISAASQQRWGKAADAGVFDAEIVPVTIPAKKRGQEPTIMARDEHGRPGTTVEKLAS
LRPIMGRQDEEATVTAGNASGQNDGAAAVIVTTRAKAEEKGLRPVMRLAGWSVAAVPPET
MGIGPVPATKKVLDRLGLTLDDIGAIELNEAFAAQALSVLKEWGISWEDERVNPLGSGIS
MGHPVGATGARMAVTLAHRMQRENSQYGLATMCIGGGQGLAAVFEKEN
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctcaagatattgtcatttgttccccactgcgcaccccagttggcgcttacggc
ggatccttcaccggaatcccagtccaggatcttgccaccaccgtgattaacgcaatcgtt
gatgcaaccggcatcaccggcagcgatgtcgatgatctcattttgggacagggttcccct
aacggttccgcacctgcacttggtcgcgttgtcgcactggattccaagctcggcatggag
gttccaggcatgcagcttgatcgccgttgtggctccggactgcaggctattcttaccgct
gcttcccatatcgctactggcgccgctgacctcatcattgcaggtggcgcagaatccatg
agccggactgagtacaccgtctccggcgatatccgttggggtgtcaagggcggagatatg
cagatgcgtgaccgtttggcagaagctcgcgaaaccgccggcggacgcaaccacccaatc
cctggtggcatgatcgaaactgcggaaaacctccgccgcgaatacggtatctcccgcgaa
gagcaggaccagatctccgcagcatcccagcagcgttggggcaaggcagcagacgctgga
gtattcgatgcagaaatcgtgccagtgaccatcccggcgaaaaagcgtggacaagaacca
accatcatggctcgcgatgagcatggtcgacctggaacgaccgtcgaaaagcttgcttcc
ctacgcccaatcatgggccgccaggatgaagaagccaccgttaccgctggcaacgcttcc
ggacaaaatgacggcgctgctgccgtaatcgtgaccacccgcgcgaaggcagaagaaaag
ggcctgcgtccagtcatgcgtcttgctggctggtctgttgctgccgttcctccagagacc
atgggtattggaccagttccagcaaccaagaaggtgcttgatcgcctgggactgaccttg
gacgatatcggagctatcgagctcaacgaagctttcgcagctcaggcactgtctgtgctc
aaggagtggggcatttcttgggaagacgagcgcgtcaacccactgggctcaggcatctcc
atgggccacccagtcggcgccaccggtgctcgcatggcagttaccctggcacaccgtatg
cagcgtgaaaactcccagtacggcctcgcaaccatgtgcatcggtggcggccagggtcta
gcagcagtatttgaaaaggagaactaa

DBGET integrated database retrieval system