KEGG   Clostridium carboxidivorans: Ccar_01530Help
Entry
Ccar_01530        CDS       T03979                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
cck  Clostridium carboxidivorans
Pathway
cck00260  Glycine, serine and threonine metabolism
cck01100  Metabolic pathways
cck01110  Biosynthesis of secondary metabolites
cck01120  Microbial metabolism in diverse environments
cck01130  Biosynthesis of antibiotics
cck01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cck00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ccar_01530
Enzymes [BR:cck01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Ccar_01530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 OKR_DC_1 Cys_Met_Meta_PP DegT_DnrJ_EryC1 Transposase_22
Motif
Other DBs
NCBI-ProteinID: AKN29595
UniProt: C6PWP9
Position
complement(317059..318093)
Genome map
AA seq 344 aa AA seqDB search
MGLIKDYRSDAATLPTLEMRQAMANAEVGDDFNGEDPTVNRLEKMSAKIFGKEDGMFVIS
ATMANQIAIMTSTHPGDEVLVGEESHIYNMETGALAALSGVQTRPLHSQNGQFDFKNVEK
SIHKSGLQFPLTKVLCLENTYDLNRGIPLSKEYMSELSLLAHKNDLLVYLDGARIINAAV
ALKVDPEILCQEIDMLQFSLCKGLSAPVGCVLLGTKDFIKQARRMRQRIGGGMAQAGHMA
AAGIVALKTMIPQIKIDHLNAKRLAIGLANLNNNLVNVENTLTNIVQLNLKNIKKDAYYI
SSDLQKHGIKIKVIDSTTCRFVTHRGITTEDIDETIDVLKNIFL
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgggcttaattaaagattatagaagtgatgcagcaacattgccaacattagaaatgcga
caagctatggcaaatgccgaagtaggtgatgattttaatggtgaagatccaaccgtaaat
cgattggaaaaaatgagtgctaaaatatttggaaaagaagatgggatgtttgttatttca
gctactatggcaaatcaaatagctattatgacatctactcatcctggtgatgaggtactg
gtaggtgaagaatctcacatttataatatggaaactggagcactagctgctctttcggga
gttcaaactagacctcttcacagccaaaatggacagtttgattttaaaaatgtagaaaaa
tcaattcataaaagtggattacaatttcctttaacaaaagtactatgtttagaaaatact
tacgatttaaatcgtggaattccactttccaaagagtatatgtctgaactctccttacta
gctcacaaaaatgatttactggtgtatttagatggagctcgaataattaatgctgcagtt
gctcttaaagttgatcctgaaatcctatgtcaagaaattgatatgctgcaattttctctt
tgcaagggattaagcgctcctgtggggtgtgttcttcttggtacgaaagattttattaaa
caagcacgaagaatgaggcaaagaattggaggcggaatggcacaagcaggacatatggca
gccgcaggtattgttgctcttaaaaccatgattccccaaataaaaattgatcatctaaat
gccaaacgtttagccattggacttgccaatttaaataataatctagttaatgtggaaaat
actttaactaatatagtacaattaaatcttaaaaatattaaaaaagatgcttactatata
tctagtgatctgcaaaaacatggtataaaaataaaagtaattgattcaacaacttgtcga
tttgtaactcatagaggtattacaacagaagatattgatgagacaattgatgtattaaaa
aatatatttttgtaa

DBGET integrated database retrieval system