KEGG   Clostridium carboxidivorans: Ccar_01795Help
Entry
Ccar_01795        CDS       T03979                                 

Definition
(GenBank) malonate decarboxylase subunit alpha
  KO
K13929  malonate decarboxylase alpha subunit [EC:2.3.1.187]
Organism
cck  Clostridium carboxidivorans
Brite
KEGG Orthology (KO) [BR:cck00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cck02000]
    Ccar_01795
Enzymes [BR:cck01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.187  acetyl-S-ACP:malonate ACP transferase
     Ccar_01795
Transporters [BR:cck02000]
 Other transporters
  Primary active transporters [TC:3]
   Ccar_01795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mal_decarbox_Al AcetylCoA_hyd_C
Motif
Other DBs
NCBI-ProteinID: AKN29648
UniProt: C6PQ27
Position
392286..393947
Genome map
AA seq 553 aa AA seqDB search
MNQSSLNVGSQRSWTTRRDKKAGQIAKVQKLVNGRVIPTEKIVEVLETLITSGDCVALEG
DNQKQASFLSNALNNVNPDKVNNLHMVMSSVSRPEHLDIFEKGIAKKLDFSYAGSQSLRM
AQAIEDNIVEVGAIHTYLELYGRLFVDLTPNIALVAADKADASGNLYTGANTEETPTIVE
ATAFRDGIVIAQVNELVDEVPRVDIPGSWVDFVVVSDKPYQLEALFTRDPRQITEMHILM
AMMAIRGVYEKHNVQSLNHGVGFNTAAIELLLPTYGESLGLKGKICKNWTLNPHPTLIPA
IESGWVESVHCFGGEVGMEKYVAARPDIFFTGRDGSLRSNRAMCQVAGQYAVDAFVGSTL
QMDADGHSSTVTLGRLAGYGGAPNMGSDPHGRRHATDAWLNMITEESSIARGRKLVVQMV
ETFQQGNKPVFVESLDAIKVGKDAKLPIAPVMVYGDDVTHVVTEEGIAYLYKAQNLEERR
QALTAVAGVTPIGQRNDPEVTEKLRKAGVIAFPEDLKIKRTDAKRSLLAARSIDDLVDWS
SGLYEPPAKFQSW
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaatctagtttaaatgttggttcacaacgttcatggactactcgacgtgataaa
aaggcaggccaaattgccaaagtacaaaagttagtaaatgggcgagttataccaacagaa
aaaattgtagaagttcttgaaacacttataacatcaggggattgtgtggctttagaagga
gataatcaaaaacaagcatccttcctttcaaatgcacttaataatgtaaatccggataaa
gttaataatttacatatggttatgtcaagtgtatccaggccagagcatcttgatatcttt
gaaaaagggattgcaaaaaaattggacttttcttatgcaggatctcaaagtcttcgtatg
gctcaagccattgaagacaacattgtggaggttggagcaattcatacttatcttgaattg
tatggaagattatttgttgatcttacaccaaacatagccttggttgcagcagataaagca
gatgctagtggtaatctttatactggagctaatacagaagaaacaccaactattgttgaa
gctacagcattccgtgatggaattgtaattgctcaagttaatgaattagttgatgaagta
cctagggtagatataccaggttcatgggtagattttgttgtagtatccgacaagccatat
caattggaggcattatttacaagagatcctagacagattacagaaatgcatattcttatg
gctatgatggctattcgtggagtatatgaaaaacataatgtacaatctcttaatcatggg
gtaggttttaatacagcagcaatagaattacttcttcctacttatggtgaatcacttgga
ctaaagggtaagatatgcaaaaactggactcttaatccacatccaacattaattccagct
atagagagtggatgggtggaaagtgtgcattgctttggtggagaagtaggcatggaaaag
tatgttgcagcaagaccagatatattctttacaggtagagatggaagtcttcgttcaaat
cgtgcaatgtgtcaggttgctgggcaatatgcagtagatgcatttgttggatctacgctt
caaatggatgctgatggtcattcttcaacagttacacttggaagacttgcaggttatgga
ggagctcctaatatgggctcagatccccatggaagaaggcatgctacagatgcttggcta
aacatgataacagaagaaagttcaattgctcgtggtagaaaattagtggttcaaatggtt
gaaacctttcaacagggcaataaacctgtatttgtagaatcattggatgcaattaaagta
ggaaaagatgctaagttaccaattgcaccagttatggtatatggtgatgatgtaacccac
gtagtaactgaagaaggaattgcttatttgtataaagctcagaatttagaagaacgccgt
caagcattgactgctgttgctggagtaactccaattggacagagaaatgatccggaggtt
acagaaaaattgagaaaagctggagtaatagctttcccagaagatcttaaaataaaacgt
accgatgctaaacgttctttacttgcagcaaggagtattgatgatcttgtagattggtct
tcaggcttatatgaaccaccagctaaattccagagttggtaa

DBGET integrated database retrieval system