KEGG   Clostridium carboxidivorans: Ccar_04220Help
Entry
Ccar_04220        CDS       T03979                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cck  Clostridium carboxidivorans
Pathway
cck00071  Fatty acid degradation
cck00072  Synthesis and degradation of ketone bodies
cck00280  Valine, leucine and isoleucine degradation
cck00310  Lysine degradation
cck00362  Benzoate degradation
cck00380  Tryptophan metabolism
cck00620  Pyruvate metabolism
cck00630  Glyoxylate and dicarboxylate metabolism
cck00640  Propanoate metabolism
cck00650  Butanoate metabolism
cck00900  Terpenoid backbone biosynthesis
cck01100  Metabolic pathways
cck01110  Biosynthesis of secondary metabolites
cck01120  Microbial metabolism in diverse environments
cck01130  Biosynthesis of antibiotics
cck01200  Carbon metabolism
cck01212  Fatty acid metabolism
cck02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cck00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ccar_04220
   00630 Glyoxylate and dicarboxylate metabolism
    Ccar_04220
   00640 Propanoate metabolism
    Ccar_04220
   00650 Butanoate metabolism
    Ccar_04220
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Ccar_04220
   00072 Synthesis and degradation of ketone bodies
    Ccar_04220
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Ccar_04220
   00310 Lysine degradation
    Ccar_04220
   00380 Tryptophan metabolism
    Ccar_04220
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Ccar_04220
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Ccar_04220
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_04220
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cck04147]
    Ccar_04220
Enzymes [BR:cck01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Ccar_04220
Exosome [BR:cck04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ccar_04220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AKN30073
UniProt: C6PW52
Position
complement(981617..982777)
Genome map
AA seq 386 aa AA seqDB search
MKKKVYIIGGLRTPIGKTNGCLKDFLPEKLAAFIIKSLIHKYKLQRDSIEEIILGNAIGP
GGNIARLSLLEADLPFNTVGTTIDFQCGSSLKAINLAGNLIRSGQRNIVLAGGVESTSLA
PNKQYNPRDSRYKGKDVFFKRAQFSPCSIGDPDMIEGAENTAKYCNITRKAMDTWALQSH
IRALEARNENKLEDIICSIQTDEKIIKDDENIRRNPSLKLMERTVPILGVHGTITAGNAC
STNDGSALIIMASEEAVQKYNLHPEALWIDGESSGVDPNLFPLGAIAASKKLLKLYDFNI
DDMDFIEINEAFAVKVLAFLKYFNYPEHRVNIFGGALAYGHPYGASGGIIMIHLLEALKY
NNKKRGMATLGVAGGLGESAIIERCD
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaaggtttatataataggaggactcagaacaccaataggcaaaactaatgga
tgtttaaaggattttcttcctgaaaaactggcagcctttataattaaaagccttatacat
aaatacaagcttcaaagagattctatagaggaaatcattcttggaaatgctataggacca
ggtggtaatattgcaagactcagcttgctagaagcagatttgccctttaatacagttggt
acaaccatagattttcaatgtggttcttcactaaaagctataaacctagcaggaaattta
ataagatctggtcagagaaatattgttctagcaggtggagtagaaagtacaagcttagct
cctaacaagcagtataatccaagagattctaggtataaaggaaaagatgttttttttaaa
agagcacaattttccccctgctcaattggcgatcctgatatgatagaaggtgctgaaaat
acagcaaagtattgcaatattaccagaaaggctatggatacatgggcacttcaaagtcat
ataagagcattagaggcaagaaatgaaaacaaacttgaagatataatctgcagtatacaa
actgatgaaaaaatcattaaagatgatgaaaacattagaagaaatccttccttaaagctt
atggaaagaactgtgccaattttaggagttcacggcactataactgctggaaatgcttgc
agtaccaatgatggatcagctcttataattatggcctctgaagaagcagtacaaaaatat
aacctgcatcctgaagccctatggattgatggagaaagttcaggagttgatccaaaccta
tttccacttggagctattgctgcttcaaaaaaacttttgaaattatatgattttaacatt
gatgatatggattttatagagataaatgaagcttttgctgtaaaggtgctggcattttta
aagtactttaattatccagagcatagagtaaacatatttggaggagccttggcatatgga
catccttatggagcatcaggaggtattataatgattcatcttttagaagctttaaagtat
aacaataaaaaaagaggaatggcaacattaggagttgctggaggattgggagaatccgct
atcatagaaaggtgtgattag

DBGET integrated database retrieval system