KEGG   Clostridium carboxidivorans: Ccar_15885Help
Entry
Ccar_15885        CDS       T03979                                 

Definition
(GenBank) pseudouridylate synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
cck  Clostridium carboxidivorans
Brite
KEGG Orthology (KO) [BR:cck00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cck03009]
    Ccar_15885
Enzymes [BR:cck01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     Ccar_15885
Ribosome biogenesis [BR:cck03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    Ccar_15885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 PA14
Motif
Other DBs
NCBI-ProteinID: AKN32261
Position
complement(3619455..3620357)
Genome map
AA seq 300 aa AA seqDB search
MEKNKLIFRVKGNEEGMKLRAYLKDVQKLSSRLIKGAALDGRISVNNNRVKLNYVIKLDD
EIAFDVEKKESQNIEPEKMDIDVVYEDSDLIVVNKQPGMVVHPTKSYPNGTLANGLLYYF
KEKGEQCIVRLVSRLDMDTSGLIIIAKNQFAHMSLARDMHKEDFEKSYLAVVHGNLKEKE
GIINLPIYRTDDGNIRRVVDERGQESITCYSVQESFNKGDLVKLTLKTGRTHQIRVHMTH
IGHPLYGDTLYGQIEDKEYIERQALHAYRLVFPHPRTREMLELEIGLPKDLQELIEKIKN
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaaataagcttatttttagagtaaaaggtaatgaagaaggtatgaagcttaga
gcatatcttaaagatgttcaaaaactttcaagcaggcttattaaaggagcagcacttgat
ggaagaataagtgtaaataataatagagttaagttaaattatgttattaaacttgatgat
gaaatagcttttgatgtagaaaaaaaggaaagccaaaatatagaaccagaaaaaatggat
atagatgtagtttatgaggatagcgatcttatagtagtaaataaacaaccaggtatggta
gttcatcctacaaagagttatccaaatgggactttagctaatggacttttatattatttt
aaggaaaagggagaacaatgcatagtaagattagtcagcagattggatatggatacttca
ggccttattataatagcaaagaatcaatttgcacatatgagtctagctagagacatgcat
aaggaagactttgaaaaaagttatttagctgtggtacatggcaatttaaaggaaaaggaa
ggaataataaatcttcctatatatagaactgatgatggaaatataagaagagttgtagat
gaaagaggacaggaaagcataacctgttatagtgttcaggaaagttttaataagggagat
ttagttaagctcactttaaaaactggaagaacacatcaaataagggttcatatgacacat
atcggacatccgttgtatggtgatactttatacggacaaattgaggataaggaatatata
gaaaggcaagctttacatgcctatagactagtatttccacaccctagaaccagagagatg
ttagaattggaaataggacttccaaaagatttacaagaattaatagagaaaataaaaaat
tga

DBGET integrated database retrieval system