KEGG   Hungateiclostridium clariflavum: Clocl_1499Help
Entry
Clocl_1499        CDS       T01661                                 

Definition
(GenBank) pyruvate/oxaloacetate carboxyltransferase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
ccl  Hungateiclostridium clariflavum
Pathway
ccl00620  Pyruvate metabolism
ccl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Clocl_1499
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ccl02000]
    Clocl_1499
Enzymes [BR:ccl01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     Clocl_1499
Transporters [BR:ccl02000]
 Other transporters
  Primary active transporters [TC:3]
   Clocl_1499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like TGT
Motif
Other DBs
NCBI-ProteinID: AEV68146
UniProt: G8M228
Position
1723603..1725000
Genome map
AA seq 465 aa AA seqDB search
MAKVKITETVLRDAHQSLIATRMRIEEMIPILEKLDNIGYHSLEAWGGATFDACLRFLNE
DPWERLRTIKKYCKKTKLQMLLRGQNLLGYKHYADDVVEYFVQKAVANGMDIIRIFDALN
DPRNIETAIKACKKEGGHAQGTVCYTISPVHNLELFVKDAKQLVEMGADSICIKDMAGLL
VPYTAYELVKAIKESVKVPVQLHTHYTSGVASMTYLKAIEAGCDIVDCAISPMSMGTSQP
PTEPLVATLKDTPYDTGLDLAKLSEIADYFRPLKEKYVQSGLLDIKVMGVDVNTLIYQVP
GGMLSNLVSQLKQSNAVDKFEEVLKEVPRVREDFGYPPLVTPTSQIVGTQAVLNVVTGER
YKMVPKESKALVKGEYGRTPAPVNPEIQKKILNGEEPITARPADFIEPELQSIKEQMKEY
LEQDEDILSYALFPQVAEKFFQYRKAQKYKIEPEMVDYENRVHPV
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagtaaaaattaccgaaaccgttcttagggacgcgcatcagtcacttatagct
acaagaatgagaattgaagaaatgatccctattttggagaagttagataatataggatac
cattcgttggaagcatggggaggagctacctttgatgcctgcttaagatttttgaatgaa
gacccatgggaaagacttaggacaattaaaaagtattgtaaaaagacaaagcttcaaatg
cttttaagaggtcaaaaccttttaggatacaaacactatgctgacgatgttgttgaatac
tttgtacaaaaggctgttgccaacggtatggacatcataagaatatttgatgccctaaat
gacccaagaaatattgaaacagcaattaaggcgtgtaaaaaagaaggcggtcatgcccag
ggaacagtttgctatacaataagtcctgttcacaatcttgaactgtttgtaaaggacgca
aaacaactggttgaaatgggtgccgactccatctgtattaaagatatggcaggtttgtta
gtgccttatacagcttatgaacttgtaaaggcaattaaggagagtgttaaagtacctgtt
cagcttcatacccactataccagtggtgttgcttcaatgacttaccttaaagcaattgag
gcaggatgtgatatagttgactgtgctatatcacctatgtcaatgggtacttctcagcca
ccaactgagccgttggttgcaaccttaaaggatacaccgtatgacaccggtttggatctc
gcaaagcttagtgaaattgccgattacttcagaccgcttaaggaaaaatatgttcaaagc
ggactgttggatatcaaggttatgggtgtagatgtaaatacccttatataccaagttcct
ggcggtatgctttcaaaccttgtttcacagcttaagcagtccaatgctgttgacaagttt
gaagaagtgcttaaagaagtaccgagggttcgtgaagatttcggatatccgccgctcgtt
actcctaccagccagatagttggaacacaggcagtattgaatgtagtaaccggtgagaga
tacaagatggtgccaaaagaatctaaagcccttgtaaaaggagaatatggaagaactcct
gctccagttaatccagaaatacagaagaagattttaaatggcgaagagcctataacagca
aggccggctgactttatagaacctgaattacagtcaattaaagagcagatgaaggaatac
ctcgagcaggatgaggatatactttcctatgcactattcccacaggttgccgagaagttc
ttccaatatcgtaaagcgcaaaagtataagattgagccggaaatggtggactatgaaaac
agggtacatcccgtataa

DBGET integrated database retrieval system