KEGG   Clostridium clariflavum: Clocl_2720Help
Entry
Clocl_2720        CDS       T01661                                 

Definition
(GenBank) 2-oxoacid:ferredoxin oxidoreductase, alpha subunit
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
ccl  Clostridium clariflavum
Pathway
ccl00010  Glycolysis / Gluconeogenesis
ccl00020  Citrate cycle (TCA cycle)
ccl00620  Pyruvate metabolism
ccl00633  Nitrotoluene degradation
ccl00640  Propanoate metabolism
ccl00650  Butanoate metabolism
ccl00680  Methane metabolism
ccl01100  Metabolic pathways
ccl01120  Microbial metabolism in diverse environments
ccl01130  Biosynthesis of antibiotics
ccl01200  Carbon metabolism
Module
ccl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ccl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clocl_2720
   00020 Citrate cycle (TCA cycle)
    Clocl_2720
   00620 Pyruvate metabolism
    Clocl_2720
   00640 Propanoate metabolism
    Clocl_2720
   00650 Butanoate metabolism
    Clocl_2720
  Energy metabolism
   00680 Methane metabolism
    Clocl_2720
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Clocl_2720
Enzymes [BR:ccl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Clocl_2720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C
Motif
Other DBs
NCBI-ProteinID: AEV69277
UniProt: G8M2B8
Position
complement(3162888..3164075)
Genome map
AA seq 395 aa AA seqDB search
MGYKAFLSGNEAVAEGVRLSKPHVIAAYPITPQTVVVERLAEMVEKGSLKSEFLHVESEH
SALSACMGASSIGARTFTATSSQGLLYMAECLHYASGGRFPIVMMNANRSLALPWSIYGD
HRDSMSLLDSGWIQVYAEDAQESLDMVIQSYAIAENLKVLTPVMLNLDGFVLTHTYELVD
VPSEEEVDKFLPPFDTPYKMDLENPKNMGFSSSPADNMEFKYQQHKAVLDARRVIKEVDE
AFGKAFGRSYGGLVDAYQCEDADFILVSLGSTTGTVRTVVDELREEGIKAGLVKIRFMRP
FPEEEIVQLVRNTKAVGVIDRDISFGYEGTVFTNVNSALAKADLQLPKLNFIAGLGGRDI
SKEDIREAFFDLIEASEGKKKERVKFLSLGVEIYE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgggatataaagcatttctttcgggtaatgaggctgtggctgaaggagtaaggctttca
aagcctcatgtaattgctgcttatccgattactcctcagacggttgtagtggaacgtttg
gctgaaatggtggaaaagggctcgttaaagtcggaatttttgcatgtggaatcggaacat
tcggcactgtcggcatgcatgggagcttcgagcattggggcaagaacctttacggctact
tcttcccagggccttttgtatatggcggaatgtcttcattatgccagcggagggaggttt
cctatagtcatgatgaatgcaaaccgttccctggctttgccctggagtatatacggcgac
caccgggattccatgtcccttttggacagcggctggattcaggtttatgcggaagatgcc
caggaaagtctcgatatggtaatccaatcctatgccatagctgaaaacttgaaggtactt
accccggtgatgctcaatctcgacggttttgtgctgactcatacttacgaactggtggat
gttccatcagaggaagaagtggataaatttctgccgccctttgacactccgtataaaatg
gatttggagaacccgaagaatatgggttttagctcttcacccgccgacaatatggaattt
aaatatcagcagcataaagcagtactggatgcaagacgggttataaaagaggtggatgaa
gctttcggaaaggccttcggacgaagttacggcggtcttgttgatgcttatcaatgcgag
gatgccgattttatacttgtgagtttgggaagtactacaggaacagtgagaacggtggtg
gatgagcttcgggaagagggaattaaggcaggacttgtaaaaatacgttttatgcgcccc
ttcccggaagaggaaattgtacaattagttaggaatacgaaagctgtaggggtaatagac
agggatatttcctttggatatgagggaacagtctttacaaacgtcaattcagcccttgca
aaagcggatttacagcttcctaaactgaattttattgcaggacttggaggaagagatatt
tcaaaggaagatattcgggaggctttcttcgatttgatagaagcatcagagggaaagaag
aaggaacgggtgaagtttttaagtctgggggtggaaatttatgagtaa

DBGET integrated database retrieval system