KEGG   Clostridium clariflavum: Clocl_2722Help
Entry
Clocl_2722        CDS       T01661                                 

Definition
(GenBank) 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
ccl  Clostridium clariflavum
Pathway
ccl00010  Glycolysis / Gluconeogenesis
ccl00020  Citrate cycle (TCA cycle)
ccl00620  Pyruvate metabolism
ccl00633  Nitrotoluene degradation
ccl00640  Propanoate metabolism
ccl00650  Butanoate metabolism
ccl00680  Methane metabolism
ccl01100  Metabolic pathways
ccl01120  Microbial metabolism in diverse environments
ccl01130  Biosynthesis of antibiotics
ccl01200  Carbon metabolism
Module
ccl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ccl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clocl_2722
   00020 Citrate cycle (TCA cycle)
    Clocl_2722
   00620 Pyruvate metabolism
    Clocl_2722
   00640 Propanoate metabolism
    Clocl_2722
   00650 Butanoate metabolism
    Clocl_2722
  Energy metabolism
   00680 Methane metabolism
    Clocl_2722
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Clocl_2722
Enzymes [BR:ccl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Clocl_2722
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-ProteinID: AEV69279
UniProt: G8M2C0
Position
complement(3164373..3164918)
Genome map
AA seq 181 aa AA seqDB search
MIEIRWHGRGGQGSFTASKLLGASAALYGGKYALAFPSFGPERRGAPVLAFTKIDDKKIN
DRSEIKKCDYIVVLDETLFHESFFNDLKDNGSIIVNSADSKAYSSYDKTKIKTVDATSIA
LEILGKPITNTAMLGALLAVSDIVRLDALKKGMESFMKGSLLEKNIEVVERIFFRMKGES
L
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaatcagatggcatggccggggaggccagggcagtttcacagcttcaaagctt
ctcggtgcatcggcggccctatatggcggaaaatatgcccttgcttttccttcctttgga
cctgagagaagaggggcaccggtcctggcttttacaaaaatagatgacaaaaagataaat
gaccgcagcgaaattaaaaagtgcgattatattgtggttttagatgagactcttttccat
gaaagttttttcaatgacttaaaggacaatggaagtattattgtaaattctgcagacagt
aaagcatattcaagttatgataaaacaaaaatcaaaacagtggatgcaacctccattgcc
ctcgaaattctaggaaagccaataaccaatacagcgatgctgggggctcttttagcagta
tcggatattgtcagactggatgctttgaaaaaaggaatggagagctttatgaaaggctca
ttgcttgaaaaaaacattgaagtggttgaaagaattttcttccggatgaaaggagagtcc
ctatga

DBGET integrated database retrieval system