KEGG   Hungateiclostridium clariflavum: Clocl_3367Help
Entry
Clocl_3367        CDS       T01661                                 

Definition
(GenBank) phosphate/sulfate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
ccl  Hungateiclostridium clariflavum
Brite
KEGG Orthology (KO) [BR:ccl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Clocl_3367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 PRRSV_2b
Motif
Other DBs
NCBI-ProteinID: AEV69866
UniProt: G8LXE8
Position
complement(3961064..3962116)
Genome map
AA seq 350 aa AA seqDB search
MTITLSSFLSELMRNPPLVITTLLTLGVILVNGWTDAPNAIATAISTRSIKPRNAIIIAS
VFNFLGVFVMTMVNSSVAETIYNMVDFGGDPDSALVALCAALFAIVLWATAAWWFGIPTS
ESHALIAGISGAAIALQGGIKGINFNEWVKVLYGLVLSIALGFIMGWLVVRIVEIIFGRV
NRTKTYSFFKNAQILGSAGMAFMHGAQDGQKFMGVFMLGMFLAKGQSDVTTFHIPSWLIV
LCSLVISFGTSIGGYRIIKSVGMDMVKLEKYQGFSADLAGVICLFIASATGLPVSTTHTK
TTAVMGVGAAKRISSVNWGIVKEMIMAWILTFPGCGLIGFLMALLFMSIF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgacaattacattaagttctttcttgagtgaactgatgagaaatcctcctttagtcata
accacactgttgacattaggggttatattggttaacggttggaccgatgcacctaatgca
attgctactgcaatatctacaaggtcaattaagcccaggaatgctattattattgcatct
gtttttaactttctcggtgtttttgtaatgactatggtaaacagcagtgtggctgaaacc
atttataatatggttgactttggaggagatccggattcagcgcttgtagcactatgtgca
gctctttttgctattgtactttgggcaacggccgcctggtggtttggaattcctacaagt
gaaagccatgcattgatagcgggaataagcggtgcagctattgcgctgcaaggtggtatc
aaaggtataaatttcaatgagtgggttaaggttctttacggattggtgctatccatagca
ttagggtttataatgggatggctggttgtcagaatagttgaaatcatatttggaagagta
aacagaactaaaacctattccttttttaagaacgctcagatacttggaagtgccggaatg
gctttcatgcatggtgcacaggacggacagaaattcatgggtgtattcatgttgggaatg
ttccttgcaaaaggacaaagtgatgttaccacctttcatatcccgtcctggctcattgtc
ctttgttcgcttgtaatatcctttggtacttctataggaggctatcgtataataaagtct
gtaggaatggatatggtaaaactcgaaaaatatcaaggattttcggcagatctggcagga
gttatttgtctgttcatagcatctgcgacaggtttgcctgttagtacaacccatacaaaa
actacggcggttatgggagttggagctgcaaaacgtatttcatccgtaaactggggaatt
gtaaaggaaatgataatggcatggattttgactttcccgggatgcgggcttataggtttc
ttgatggcattattgtttatgagtattttttaa

DBGET integrated database retrieval system