KEGG   Capnocytophaga canimorsus: Ccan_04760Help
Entry
Ccan_04760        CDS       T01582                                 

Definition
(GenBank) Hydroxymethylbilane hydrolyase (cyclizing)
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ccm  Capnocytophaga canimorsus
Pathway
ccm00860  Porphyrin and chlorophyll metabolism
ccm01100  Metabolic pathways
ccm01110  Biosynthesis of secondary metabolites
ccm01120  Microbial metabolism in diverse environments
Module
ccm_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:ccm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ccan_04760
Enzymes [BR:ccm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Ccan_04760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AEK22598
UniProt: F9YS45
Position
521644..522294
Genome map
AA seq 216 aa AA seqDB search
MRILLATKILSETQKKSFEYSDFQIIQHDFITIKHSAILPQITGDILLFTSQNAVRSVLK
SQMLLHLKSIPAVCVGEKTAKLLKENGWKVLFFKPYAADLAVEILQKIGHRKITFFCGNL
RRDTLPDFFNKHNLAFEEIQVYQTHYTPETISEKVYGILFFSPSEVKSYLLKNSITTQIL
FCIGTTTAQEAQKHSLKVVIADSPTVESVIAKCLEY
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatccttcttgctaccaaaatactttcagaaacacaaaaaaaatcttttgaatat
tctgattttcaaattatacaacacgatttcataactattaagcatagtgctatattgcca
caaatcacaggcgatatattgctttttaccagtcaaaatgcggtaagaagtgttttaaaa
agccaaatgcttcttcatttaaaaagcatacctgccgtttgtgtaggagaaaagacagcc
aaattactgaaagaaaatggttggaaagtccttttctttaagccttatgctgccgatttg
gctgtggaaattttgcaaaaaatagggcatcggaaaataacttttttctgcggaaacctg
cgccgtgacacgcttcctgatttttttaacaaacataacctcgcctttgaagagatacag
gtgtaccaaacccattatacgccagagacaatatccgaaaaagtctatggcattctgttt
ttcagcccctctgaggttaaaagttacttacttaaaaattcaataaccactcaaatactt
ttttgtatcggcaccactactgctcaagaggctcaaaaacactccctaaaagtggttata
gctgactcgcctaccgtggaaagtgtaatagccaaatgtttggaatattaa

DBGET integrated database retrieval system