KEGG   Corynebacterium callunae: H924_00320Help
Entry
H924_00320        CDS       T02507                                 

Definition
(GenBank) geranylgeranyl pyrophosphate synthase
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
ccn  Corynebacterium callunae
Pathway
ccn00900  Terpenoid backbone biosynthesis
ccn01100  Metabolic pathways
ccn01110  Biosynthesis of secondary metabolites
ccn01130  Biosynthesis of antibiotics
Module
ccn_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:ccn00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    H924_00320
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:ccn01006]
    H924_00320
Enzymes [BR:ccn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     H924_00320
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     H924_00320
    2.5.1.29  geranylgeranyl diphosphate synthase
     H924_00320
Prenyltransferases [BR:ccn01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   H924_00320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: AGG65524
UniProt: M1UIJ3
Position
71569..72654
Genome map
AA seq 361 aa AA seqDB search
MMVEIETSAIDYEIRAMFRTVIDKTEGHHPSFRKALHIAANSALGGKLLRPRLFLDLYEV
LADPDDKFRYDGVESPVKEIAAAIEVLHFAFLLHDDVIDGDFIRRGRPNFISRLAQQSKI
STDDHHDAERKEWARSSAILIGDLLLAEVHQIFARLDLPHAKRLQLLDLLDHAITDSIIG
EFMDVSLSKGLISPQLADVQQMSRLKTATYTFELPLCSAAIMAGYDPQKSAEFATLGGLL
GLLFQFQDDFLSAFGNQAEHGKDELSDVREGKETLIIAYARKTAAWPLIQPYFGNANLNK
ENIREIKELLVTCGAQSFLEDTIAHTARLCRDQILRITAFSPAEVPVLLNALVDSLEGRR
S
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgatggtcgagatagaaaccagcgcgatagattatgaaattcgcgcgatgttccgcaca
gtcattgataaaactgagggccatcatcccagctttagaaaagcactgcatatagccgcc
aattctgccttgggtggaaagctactgcgtccgcggctctttttggatctctacgaggtt
ttagcggatccagacgataaattccgctatgacggggtggagtctccggttaaggaaata
gcagcagctatcgaggttctgcactttgcattcctcttacatgatgatgtcatcgatgga
gatttcattcgtcggggtcgccccaatttcatttcccgtctcgctcagcaatctaaaatc
agcaccgatgaccatcatgatgctgagcgcaaagaatgggcgcgctccagcgccatcctg
attggtgatctgctgcttgcagaagtccatcagatttttgcacgccttgacctgccacat
gctaagcgtctgcagctgctcgatcttttagaccatgcaattactgactccattattggt
gagtttatggatgtatccctgagcaaagggcttattagtccgcagctagcagacgttcag
caaatgagccgacttaaaaccgccacttataccttcgaattgcccctctgtagtgcagcc
atcatggctggatacgacccgcaaaagagcgcagagttcgcaactctaggcggactttta
ggactgcttttccaattccaggatgatttcctctctgcttttggtaatcaggcagagcat
ggaaaagacgagctctccgatgtccgggaaggcaaagaaacacttattattgcctatgcg
cgaaaaacggcagcctggcctcttattcaaccctactttggaaatgcaaacctcaataag
gaaaatataagagagattaaagaacttcttgtcacgtgtggtgcccaaagtttcttggaa
gacacaattgcacacaccgctcgtttgtgcagagatcagatcctgaggatcactgcattt
agcccagcggaagttccagttttacttaatgcattagtggattcgctggaaggcagacgc
tcatga

DBGET integrated database retrieval system