KEGG   Corynebacterium callunae: H924_05255Help
Entry
H924_05255        CDS       T02507                                 

Definition
(GenBank) hypothetical protein
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
ccn  Corynebacterium callunae
Brite
KEGG Orthology (KO) [BR:ccn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ccn03009]
    H924_05255
Enzymes [BR:ccn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     H924_05255
Ribosome biogenesis [BR:ccn03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    H924_05255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_12 Methyltransf_31 Methyltransf_32 Methyltransf_23 Ubie_methyltran Methyltransf_4
Motif
Other DBs
NCBI-ProteinID: AGG66497
UniProt: M1UTJ7
Position
1101148..1102017
Genome map
AA seq 289 aa AA seqDB search
MLSHIIDVLADPIDGTALEGVDDFTRLVSESGHSYDVARQGYVTLAGGAGLRYSGDDAQM
IADRETFLSGGHFAPFVESITNHVQAVFDAAELGDDQQPVVCEIGAGTGYYLAHTLDSIT
DSRGIGIDVSVHAAKHLAKVHPRVGAVIADAWARLPIKDESVDAITVIFAPRNAAEFARI
LKPKGQVIVLTAEIGHLSELREPLGIIDVEAGKVDRMIEQAAGHLRPVGESELVEFEMTL
DQQSIASQIGMSPSARHIKPEALAERIAALPEKMQVTARARITCLERIS
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
gtgctttcccacatcatcgatgttctagcagaccccattgacggcaccgctttagaaggt
gtcgacgatttcaccaggttggtgtctgaatctggccattcatatgacgttgcccgccag
ggttatgtcactttggctggaggagcgggtcttcgctattccggcgatgacgcccagatg
atcgctgatagggagaccttcctctccggcggacattttgcgcctttcgttgaatccatc
accaatcacgtgcaagcagtttttgatgctgcagagctcggtgatgatcagcaaccggta
gtttgtgaaattggtgcaggtaccggttactaccttgcccatactttggattcaattact
gattcccgcggtattggcattgacgtatccgtacacgcggcaaagcacctggctaaggtt
catccacgagttggcgccgttattgctgacgcttgggcgcgtttgcccattaaagatgaa
tccgtagatgccatcaccgttatcttcgcaccccgcaatgcagctgagttcgcccgcatt
ctcaagccaaagggccaagttattgtgttgaccgcagagatcggccacctctctgaactg
cgtgagccactgggcattatcgacgtagaagctggcaaagttgatcgcatgatcgaacaa
gccgcaggccatttgcgtcctgttggcgaaagtgaattagttgagtttgaaatgactttg
gaccagcagtccattgcttctcaaattggcatgagcccttcggctcgccacatcaagcct
gaggcattggcagagcgtatcgcagcccttcctgaaaagatgcaggtcactgcacgcgcc
cgcatcacttgcctggagcggattagctaa

DBGET integrated database retrieval system