KEGG   Corynebacterium callunae: H924_10065Help
Entry
H924_10065        CDS       T02507                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ccn  Corynebacterium callunae
Pathway
ccn00071  Fatty acid degradation
ccn00072  Synthesis and degradation of ketone bodies
ccn00280  Valine, leucine and isoleucine degradation
ccn00310  Lysine degradation
ccn00362  Benzoate degradation
ccn00380  Tryptophan metabolism
ccn00620  Pyruvate metabolism
ccn00630  Glyoxylate and dicarboxylate metabolism
ccn00640  Propanoate metabolism
ccn00650  Butanoate metabolism
ccn00900  Terpenoid backbone biosynthesis
ccn01100  Metabolic pathways
ccn01110  Biosynthesis of secondary metabolites
ccn01120  Microbial metabolism in diverse environments
ccn01130  Biosynthesis of antibiotics
ccn01200  Carbon metabolism
ccn01212  Fatty acid metabolism
ccn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ccn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    H924_10065
   00630 Glyoxylate and dicarboxylate metabolism
    H924_10065
   00640 Propanoate metabolism
    H924_10065
   00650 Butanoate metabolism
    H924_10065
  09103 Lipid metabolism
   00071 Fatty acid degradation
    H924_10065
   00072 Synthesis and degradation of ketone bodies
    H924_10065
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    H924_10065
   00310 Lysine degradation
    H924_10065
   00380 Tryptophan metabolism
    H924_10065
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    H924_10065
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    H924_10065
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    H924_10065
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccn04147]
    H924_10065
Enzymes [BR:ccn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     H924_10065
Exosome [BR:ccn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   H924_10065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III FG-GAP
Motif
Other DBs
NCBI-ProteinID: AGG67449
UniProt: M1UMN0
Position
2171133..2172365
Genome map
AA seq 410 aa AA seqDB search
MSENPQDIVICSPLRTPVGAYGGSFTKVPVQELATTVINAIVDATGLTGDDVDDLILGQA
SPNGAAPALGRVVALDSKLGQNVPGLQLDRRCGSGLQAIVTAAAHVATGAADIIIAGGAE
SMSRTEFTVSGDIRWGVKGGDMQMRDRLAEARESAGGVNHPIPGGMIETAENLRREYGIS
REEQDALSAASQQRWGKAADAGLFDAEIVPVTVPAKRRGQEPTIVSRDEHGRPDTTVEKL
AALRPIMGRQDAEATVTAGNASGQNDGAAAVVVTTRAKAAEKGLTPMMRLVSWSVAAVPP
ETMGIGPVPATKKALERAGLTLDDMGSIELNEAFAAQALSVLREWGISWEDERLNPLGSG
ISMGHPVGATGARMVVTLAHRMQREDSQYGLATMCIGGGQGLAAIFEKEN
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagaacccacaagacatcgtcatttgctccccactacgcaccccagttggtgct
tatggcggatccttcaccaaggttccagtccaggaactagctaccaccgtaatcaatgcc
atcgttgacgccaccggactcaccggcgacgacgttgatgatctgatcttgggccaggct
tcccctaatggtgcagctccagccttgggccgtgttgttgccctcgattccaagcttggc
caaaacgttcctggcctgcagcttgatcgtcgctgtggatccggcctgcaggcaattgtt
actgcagcagctcacgttgccaccggcgcagctgacatcatcatcgcaggtggtgctgag
tccatgagccgcactgaattcaccgtttccggtgatatccgttggggtgttaaaggtgga
gatatgcagatgcgcgatcgtctggccgaggctcgtgagtccgccggtggagtgaaccac
ccaattcctggcggcatgattgaaaccgctgagaacctgcgccgcgaatacggcatttcc
cgtgaagagcaggatgcactttccgcagcttcccagcagcgttggggcaaagctgctgat
gctgggcttttcgacgcggagatcgtgccagttactgttcctgccaagcgtcgcggccag
gagccaaccatcgtgtctcgtgatgagcacggtcgtccagataccaccgtcgaaaagctt
gctgcactgcgcccaattatgggccgccaggacgcagaagccaccgttaccgcaggtaac
gcttccggccagaatgacggcgctgctgcagtggtggttaccacccgcgccaaggctgcg
gaaaagggcctgaccccaatgatgcgcctggttagctggtctgttgctgctgttcctcca
gagaccatgggtattggaccagtgcctgccaccaagaaggctttggagcgtgccggactt
acccttgatgacatgggttccatcgagctcaacgaagcttttgctgcgcaggcactgtcc
gtgctgcgcgaatggggaatctcttgggaagatgagcgcctgaacccactgggctccggc
atttccatgggtcacccagtcggcgctaccggtgctcgcatggttgtcaccttggcacac
cgcatgcagcgcgaagattcccagtacggtctggccaccatgtgcatcggtggcggccag
ggcttggcagcaatctttgaaaaggagaactaa

DBGET integrated database retrieval system