KEGG   Campylobacter concisus 13826: CCC13826_1177
Entry
CCC13826_1177     CDS       T00593                                 

Gene name
tssJ
Definition
(GenBank) type VI secretion system, membrane platform protein
Organism
cco  Campylobacter concisus 13826
SSDB
Motif
Pfam: T6SS-SciN LPAM_1
Other DBs
NCBI-ProteinID: EAT98575
UniProt: A7ZBA8
Position
133748..134215
AA seq 155 aa
MKKTFKFLCYLIFMLFVAGCAKDLIISNTPNSNLNYHGDNVPVTIIAYKLRDVAKFQQAS
IVDLAEKNGDILGQDKIDSIKTQIQPNTNRYAFTNVDPDEVPYVGILVLYADQSKTNIKA
YKSTKEAKEKNIVFEITKNGVNTIDASGSKIQASK
NT seq 468 nt   +upstreamnt  +downstreamnt
atgaagaaaacgtttaaatttctttgttatttaatttttatgctatttgtcgcaggatgt
gcaaaagatcttatcataagcaacactccaaattcaaacttaaactaccacggtgacaac
gttccagtgactatcatcgcttataagctaagagatgtggcaaaatttcagcaagctagc
atagttgatctagctgagaaaaatggcgacatacttggtcaagacaagatagactcgata
aaaacgcaaattcagccaaatacaaacagatacgcttttacaaatgtcgatccagacgaa
gtaccatacgtaggcattttggtgctttatgctgatcaaagcaagacaaatatcaaagct
tacaaatcaacaaaagaagcaaaagagaaaaatatagtttttgagataactaaaaatggc
gtaaataccatagacgccagcggctctaagatccaagcaagcaaataa

DBGET integrated database retrieval system