KEGG   Campylobacter concisus 13826: CCC13826_1590Help
Entry
CCC13826_1590     CDS       T00593                                 

Gene name
hisC
Definition
(GenBank) histidinol-phosphate aminotransferase
  KO
K00817  histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
cco  Campylobacter concisus 13826
Pathway
cco00340  Histidine metabolism
cco00350  Tyrosine metabolism
cco00360  Phenylalanine metabolism
cco00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cco00401  Novobiocin biosynthesis
cco01100  Metabolic pathways
cco01110  Biosynthesis of secondary metabolites
cco01130  Biosynthesis of antibiotics
cco01230  Biosynthesis of amino acids
Module
cco_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:cco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    CCC13826_1590 (hisC)
   00350 Tyrosine metabolism
    CCC13826_1590 (hisC)
   00360 Phenylalanine metabolism
    CCC13826_1590 (hisC)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CCC13826_1590 (hisC)
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    CCC13826_1590 (hisC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cco01007]
    CCC13826_1590 (hisC)
Enzymes [BR:cco01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     CCC13826_1590 (hisC)
Amino acid related enzymes [BR:cco01007]
 Aminotransferase (transaminase)
  Class II
   CCC13826_1590 (hisC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP Aminotran_5 Aminotran_3
Motif
Other DBs
NCBI-ProteinID: EAT99008
UniProt: A7ZCF3
Position
573606..574703
Genome map
AA seq 365 aa AA seqDB search
MKFNDFLDDLVNYEAGKPIELVVREFGIDAKDVIKLASNENPFGTSKRVEEALKEVAKNA
HLYPDDSYFELKEGLAKKFGVTSKKLIIGSGSDQIIEFALHAKANRQSGVLMAGVTFAMY
EIYAKQTGAKIYRTKSVEHNLSEFLEIYNAHKDEISVIFLCLPNNPLGECIDADEVYKFI
KNIDENTLVVLDCAYNEFAKFKDSKKEIKPSEVVKFKNAIYLGTFSKAYALGGMRVGYGV
ANEEIIGALSKLRAPFNITTPSLRAAIVALGDDEFVQKTMQNNFEQMKRYEDFAEQNGIE
FIPSYTNFITFKFNEPKSSQICEKMLKKGIILRDLKSYALNAVRITIGQAWQNDRVFEEL
EQILK
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttaatgactttttagatgatctagtaaattacgaggctggaaagccgatcgag
cttgtagttagagagtttggcatcgatgcaaaagatgtgataaagctagcgagcaacgaa
aacccttttggcacaagcaaacgcgtagaagaggcgctaaaagaggttgctaaaaacgca
catctctatccagatgatagctactttgagctaaaagaggggctagctaagaaatttggc
gtaactagcaaaaaattaatcatcggctctggaagcgaccagatcatagagtttgcactt
cacgcaaaggcaaacaggcaaagtggcgttttgatggctggcgtgacatttgcgatgtat
gaaatttatgcaaaacaaactggagctaaaatttaccgcacaaagagcgtggagcataat
ttgagcgagtttttagaaatttataacgcacacaaagatgaaatttctgtcatctttctt
tgcttgccaaacaacccattaggcgagtgcatcgatgccgatgaagtctataaatttata
aaaaacattgatgaaaacacccttgtggtgcttgattgtgcttacaacgaatttgctaaa
tttaaagatagcaaaaaagagataaagccaagcgaggtggtgaaatttaaaaatgccatc
tatcttggcactttctcaaaggcctacgcacttggcggcatgcgcgtgggatacggcgtg
gcaaatgaagagatcataggcgctctttcaaagctaagagctccatttaacatcacaact
ccaagcctaagagcagcgatagtagcgcttggggatgatgaatttgtgcaaaaaactatg
caaaacaacttcgagcagatgaagagatatgaggattttgcagagcaaaatggcatcgag
tttatcccaagctatacaaatttcatcacttttaaatttaacgagccaaaatcaagccag
atatgcgaaaagatgctaaaaaaaggtataattttacgagatttaaaaagctacgcctta
aatgcggtgagaatcaccatcggtcaggcatggcaaaacgatagagtttttgaagagtta
gagcaaattttaaagtag

DBGET integrated database retrieval system