KEGG   Campylobacter coli FB1: VC76_02575Help
Entry
VC76_02575        CDS       T03870                                 

Gene name
aldA
Definition
(GenBank) Lactaldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
ccof  Campylobacter coli FB1
Pathway
ccof00620  Pyruvate metabolism
ccof00630  Glyoxylate and dicarboxylate metabolism
ccof01100  Metabolic pathways
ccof01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ccof00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VC76_02575 (aldA)
   00630 Glyoxylate and dicarboxylate metabolism
    VC76_02575 (aldA)
Enzymes [BR:ccof01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     VC76_02575 (aldA)
    1.2.1.22  lactaldehyde dehydrogenase
     VC76_02575 (aldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC FIST_C
Motif
Other DBs
NCBI-ProteinID: AJW57939
UniProt: A0A0Q2PJP7
Position
493250..494689
Genome map
AA seq 479 aa AA seqDB search
MTTYLNYIDGKFIPHNGEFIEVLNPATKEVISRVASASLEDTKRAIEAAKKAQKVWEAKP
AIERANHLKEIASLIRKNANFLTEVLMQEQGKTRVLASIEINFTADYMDYTAEWARRYEG
EIIQSDRANEHIYLYKSAIGVIGGILPWNFPFFLIARKMAPALLTGNTIVIKPSSETPNN
AFEFAKLVSQSSLPKGVFNLVAGKGSVVGYELSSNENIGMVSLTGSVEAGTRVMEAAAKN
IIKVSLELGGKAPAIVCKDADIDLAVEAIKASRICNNGQVCNCAERAYVHTSIYDEFVDK
FVKAMSKVSVGNTLKGDFDMGPLVNQAGVDNALAMLQRATAKGAIVECGGKITDTSGYYF
PASVLTNVKHEDEIMQKEIFAPILPIAKFDTLDEAIDMANDCEYGLTSSIYTQNLDIAMR
ASREIKFGETYINRENFEAMQGFHAGFRKSGIGGADGKHGLEEYLATHVVYLQYNTNKQ
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgacaacttatttaaattatattgatggaaagtttatcccacataatggagaatttatc
gaagttttaaatccagctaccaaagaagtgatttcaagagtagctagcgcttctttagaa
gatactaaaagagcgattgaagcagccaaaaaagcacaaaaagtttgggaggctaaacca
gcgattgaaagagcaaatcatttaaaagaaatagctagtttaatacgcaaaaatgctaat
ttcttaaccgaagttttaatgcaagagcaaggaaaaaccagagttttggctagcatagag
attaattttacagcagattatatggattatacggccgagtgggctagaagatatgagggt
gaaatcatacaaagcgatagggctaatgagcatatatatttatataaaagtgctattggg
gtaattggtggaattttaccttggaattttccatttttcttaatcgcaaggaagatggca
cctgctttactaacaggaaatactattgttataaagccaagcagtgaaactccaaacaat
gcttttgaatttgcaaagcttgtttcgcaaagttctttaccaaaaggtgtttttaactta
gttgcaggtaaaggcagtgtagtaggatatgaattatcaagcaatgaaaatataggtatg
gtaagtcttacaggaagtgttgaagcagggactagagtaatggaagctgcagctaaaaat
attatcaaagtttctttagaacttggtggaaaggcgccagctatagtgtgcaaagatgcg
gatattgatttagcagtagaagcgattaaagcaagtagaatttgcaataacggacaagtt
tgtaattgtgctgaaagagcttatgtgcatacaagcatttatgatgaatttgtagacaaa
tttgtaaaagccatgagtaaagtaagtgttggaaataccttaaaaggtgattttgatatg
ggaccattggtcaatcaagcaggagttgataatgctttggcaatgcttcaaagagctaca
gctaaaggagcgattgtagaatgcggtggaaaaatcactgatacaagtgggtattatttt
cccgcaagcgttcttactaatgttaaacacgaagatgagatcatgcaaaaagaaattttt
gctccgattttacctattgctaaatttgatacacttgatgaagctattgatatggcaaat
gattgtgaatatggtcttacaagttctatttatacacaaaatttagatatagcaatgaga
gctagcagagaaattaaatttggtgaaacttatattaatcgtgaaaattttgaggctatg
caaggttttcatgcaggctttagaaaaagtggcataggcggagctgatggaaaacatggt
cttgaagaatatttagctacccatgtggtatatttgcagtataatactaataaacaataa

DBGET integrated database retrieval system