KEGG   Campylobacter coli FB1: VC76_07435Help
Entry
VC76_07435        CDS       T03870                                 

Gene name
selD
Definition
(GenBank) Selenide, water dikinase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
ccof  Campylobacter coli FB1
Pathway
ccof00450  Selenocompound metabolism
ccof01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccof00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    VC76_07435 (selD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ccof03016]
    VC76_07435 (selD)
Enzymes [BR:ccof01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     VC76_07435 (selD)
Transfer RNA biogenesis [BR:ccof03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    VC76_07435 (selD)
 Prokaryotic Type
    VC76_07435 (selD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS DUF2520
Motif
Other DBs
NCBI-ProteinID: AJW58886
UniProt: A0A0Q2QFI5
Position
complement(1457934..1458860)
Genome map
AA seq 308 aa AA seqDB search
MQTSPALLSDIGNNEDASVFQISPELALVQTLDFITPIVDSAYHFGAIAAANALSDVFAM
GAEVINALNIVGFDTCHHELNVLQELLQGANDKVQECGGIIVGGHTIESGELFFGLSVTG
KVHPKKFIANNTAKEGDLILLTKPLGTGILSTALKAQMLEEKHLDRMLESMMGLNYKSSQ
IALRFGVNAMSDVTGFGFLGHLREMLNDSISFMIFKDKLPYLEGVKEYFDMGLIPGGAYK
NLDFIQEFYPGLNEEDLLLCDPQTSGGLLISIEEKKALECLKALEDENIKAKIVAKAVAK
QDDRFIFS
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacaagcccagctttactcagtgatatcggcaataatgaagacgcaagtgttttt
caaattagtcctgaattagccttagttcaaacgcttgatttcatcacacctatagtagat
agtgcttatcattttggtgctattgctgcagccaatgctttaagtgatgtgtttgctatg
ggtgcagaggtgattaatgctttaaatatagtgggttttgatacttgccatcatgaatta
aatgtcttgcaagaattattacaaggtgcaaatgacaaggttcaagaatgtggtggcatt
atcgtgggtggacatactatagaaagtggtgagcttttctttggacttagtgtaacagga
aaggtacaccctaaaaaatttattgctaataataccgctaaagaaggggatttgattctt
ttaaccaagcctctagggacgggtattttaagtacagctttaaaagctcaaatgttagaa
gaaaaacatttagatcgtatgcttgaaagcatgatgggtttaaattataaatccagccaa
attgcacttcgttttggggttaatgcgatgagtgatgttacgggctttggtttcttagga
catttaagagagatgttaaatgatagcatttcatttatgatttttaaagataaacttcct
tatttagagggcgtaaaagaatattttgatatgggtttgattcctggtggagcttataaa
aatttagatttcattcaagagttttaccctggtttaaatgaggaagatttactgctttgt
gatcctcaaacttcaggagggcttttaatttctatagaagagaaaaaggctttagaatgt
cttaaggctttagaagatgaaaatattaaagccaaaattgttgccaaagcagtagctaaa
caagatgatagatttatattttcttaa

DBGET integrated database retrieval system