KEGG   Campylobacter coli RM5611: YSU_04210Help
Entry
YSU_04210         CDS       T03167                                 

Definition
(GenBank) biotin attachment protein
  KO
K01960  pyruvate carboxylase subunit B [EC:6.4.1.1]
Organism
ccoi  Campylobacter coli RM5611
Pathway
ccoi00020  Citrate cycle (TCA cycle)
ccoi00620  Pyruvate metabolism
ccoi01100  Metabolic pathways
ccoi01120  Microbial metabolism in diverse environments
ccoi01200  Carbon metabolism
ccoi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ccoi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YSU_04210
   00620 Pyruvate metabolism
    YSU_04210
Enzymes [BR:ccoi01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     YSU_04210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_D23
Motif
Other DBs
NCBI-ProteinID: AHK75074
Position
829425..831218
Genome map
AA seq 597 aa AA seqDB search
MAKKFIDVMDTSFRDGFQSVYGARVLMQDFFPAVEAAKEAGITHFEFGGGARFQSLYFYL
NEDAFEMMDKFRSIVGKDANLQTLARGVNTVTLDTGSKELIDLHAKLFAKHGTTTIRNFD
ALNDVNNLKFSGECIKKYGLKHEITITLMDLPPNCQGAHDVPFYERILKEILAAEIPFDS
ICFKDASGTSNPNKIYETIKMARKNLPQDVHIRLHTHETAGVSIACYLAALEAGVDGIDL
AAAPVSGGTSQPDILTMMHALKGKNYDLGGLEEEKILKYEAVLKDSLKEYFLPPEATMVS
PLIPFSPMPGGALTANTQMMRDNNILDKFPEVIHAMREVVEKGGFGTSVTPVSQFYFQQA
FNNVMFGPWEKIAEGYGKMVLGYFGKTPVEPDAEVKKLAAKQLNLEPTTELAIDIADKDE
TKSIAYVKSLLEKEGIAVSEENIFIAAACKEKGIAYLKGEAKVNVRKNVSAPKQNSTGID
ENKFTVSVNGNKYHVEISAGFDKDVNIKSIHKADTQEDIMQDADSSEGIQAGISGNVFKI
YINEGEEVKSGQVVMILEAMKMEIEVSAPKDGIIEKICVKTGDSVSENNLVAIYKNN
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaaatttatagatgttatggatacaagttttagagatggttttcaatctgtt
tacggggctagagtcttaatgcaagatttttttccagcagtagaagcagccaaagaagca
gggataactcattttgaatttggaggtggagcaaggtttcaaagcctttatttttacctt
aatgaagatgcttttgaaatgatggataaattccgttcgattgttggaaaagatgcgaat
ttgcaaactttagcaagaggtgtaaatactgttactttggatacaggaagtaaagagctt
attgatttacatgccaaactttttgctaagcatggcactacaacaattagaaatttcgat
gctttaaacgatgtaaataatcttaaattcagtggagaatgtattaaaaaatacggctta
aaacatgaaatcacaattactttaatggatttaccaccaaattgtcaaggtgcccacgat
gtaccattttatgaaagaatattaaaagaaattttagctgctgaaattccttttgatagt
atttgttttaaggatgctagcggaacttcaaatccaaataaaatttatgaaaccattaaa
atggctagaaaaaatttaccacaagatgtgcatataagacttcatacgcatgaaactgca
ggagtgagtatagcttgttatttagcagcattggaagctggggttgatggtatagattta
gcagcagctcctgtgagtgggggtacttcacagcctgatattttaactatgatgcatgct
ttaaaaggtaaaaattatgatttgggtggattagaagaagaaaagattttaaaatacgaa
gcagttttaaaagattctttaaaagagtattttttaccgcctgaagctacaatggtaagt
cctttaatcccattctctcctatgccaggaggagctttaactgccaatactcaaatgatg
agggataataatatactcgataaattcccagaagttattcatgctatgcgtgaagttgtg
gaaaaaggtggttttggaacttctgtaactcctgtttctcaattttattttcaacaagct
tttaacaatgtcatgtttggaccttgggaaaaaattgctgaaggttatggaaaaatggta
ttgggatattttggtaaaactcctgtcgagcctgatgctgaagttaaaaaacttgcagct
aaacagctaaatttagagcccactacagaacttgctatcgatatagcggataaggatgaa
accaaaagtatagcctatgttaagagtttacttgaaaaagagggcatagcggtaagcgag
gaaaatattttcattgcagcagcttgtaaagaaaaaggtatagcgtatttaaaaggtgaa
gctaaagttaatgtgcgcaagaatgtgtctgcgccaaaacaaaattctactggtattgat
gagaataaatttacagtttcagttaatggaaacaaatatcatgtagaaataagtgcaggc
tttgataaagatgtaaatattaaaagtattcacaaagcagatactcaagaagatataatg
caagatgcggattcaagcgaaggtatacaagctggaatttcgggtaatgtatttaaaatt
tatattaatgaaggtgaagaggtaaaatcgggtcaagttgttatgattttagaagctatg
aaaatggagatagaggttagtgcaccaaaagatggcataatagaaaaaatttgtgtcaag
acgggtgatagtgttagcgaaaataatttagtcgcaatatataaaaataattga

DBGET integrated database retrieval system