KEGG   Campylobacter coli RM5611: YSU_04855Help
Entry
YSU_04855         CDS       T03167                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ccoi  Campylobacter coli RM5611
Pathway
ccoi00450  Selenocompound metabolism
ccoi00970  Aminoacyl-tRNA biosynthesis
ccoi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccoi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    YSU_04855
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    YSU_04855
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ccoi01007]
    YSU_04855
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ccoi03016]
    YSU_04855
Enzymes [BR:ccoi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     YSU_04855
Amino acid related enzymes [BR:ccoi01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   YSU_04855
Transfer RNA biogenesis [BR:ccoi03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    YSU_04855
 Prokaryotic type
   Other AARSs
    YSU_04855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f DUF2072
Motif
Other DBs
NCBI-ProteinID: AHK75189
Position
949939..951825
Genome map
AA seq 628 aa AA seqDB search
MRYLTTPIYYVNDVPHLGHAYTTIIADTLARFYRLQGHETRLLTGTDEHGQKIEQAAKIR
NSTPKEYADKISSEFKKLWDEFEITYDIYARTTDTRHVEFVKAMFLKMWQKGDIYKDEYE
GHYCISCESFFAKSQLINECGCPDCGKDTSLLKEESYFFKLSKYQDKILQWYDKEDPILP
KNKKNELINFVQSGLKDLSITRTSFDWGIEIPEEIKDDKHIIYVWLDALFIYISSLDYQS
QGENAKFWPAHIHLVGKDILRFHAIYWPAFLMSVDLPLPKFIGAHGWWTKEGEKMSKSKG
NVVKPKEVVDAYGLEAFRYFLLREVPFGNDGDFSESVLINRINTELGNEFGNLLNRIIGM
SIKYNQGNISQEGVLEFYKNELDTAKEHLDNAINFLENLQCNRYLEELFKALSVANLAIS
KYEPWNLIKANKIKEANALIGLCANILAKTSLLLSPTLPKSCQKVGLALNFEISPTNYQK
LILQNELLDFKASACEALFPKIEKPLLSQEEKQEVKKEEKPKIKIDDFAKIEIKVAKVID
CQNIEGSEKLLKFKLELDNKEIRQVLSGIAKYYKASDLIGKQVCVISNLKKAKIFGHESD
GMILSAKSGDKLVLISPEQLVENGSLVG
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatcttacaactccaatttattatgtaaatgatgtgcctcacttaggacatgct
tataccactatcattgcggacactttagctagattttatcgtttgcaagggcatgagact
agattgttaacaggtactgatgaacacggacaaaaaatagaacaagcagcaaaaataaga
aactcaaccccaaaagaatacgctgataaaatcagttctgaatttaaaaaactttgggat
gagtttgaaatcacttatgatatatatgcaagaacaaccgatactaggcatgttgaattt
gttaaagctatgtttttaaaaatgtggcaaaaaggagatatttataaggatgaatatgag
ggacattattgtatttcatgtgaaagtttttttgcaaaaagtcaacttataaacgaatgt
ggatgtcctgattgtggcaaagatacttctttattaaaagaagaaagttatttttttaag
ctttcaaaatatcaagataagattcttcaatggtatgataaagaagatcctatcttgcct
aaaaataaaaaaaatgaattgattaattttgtccaaagtggacttaaagatctttctatt
actcgaacaagctttgattggggtattgaaatcccagaagaaattaaagacgataaacac
attatttatgtatggcttgatgcgctttttatttatataagctcgcttgattatcaaagc
caaggagaaaatgctaaattttggccagcccacatacacttagtaggcaaagacatcttg
cgttttcatgcgatttattggccagcctttttaatgagtgtggatttacctttgcctaaa
tttatcggcgcacacggttggtggactaaagagggtgaaaaaatgagcaagtctaaaggt
aatgtcgtaaaacctaaagaagtggtagatgcttatggcttagaggcttttagatacttt
ctgctaagagaagttccttttgggaatgatggtgattttagcgaaagtgttttgattaat
agaatcaatacagaactaggcaatgaatttggcaatttactcaaccgcatcataggaatg
agtataaaatataatcaaggtaatatttctcaagaaggcgttttagaattttataaaaac
gaacttgatacggctaaagagcacttagataacgctataaactttttagaaaacctacaa
tgtaatcgctatctagaagagctttttaaagccttaagtgttgcaaatttagccattagc
aaatacgaaccttggaatttaatcaaagcaaataaaatcaaagaagccaatgctcttata
ggactttgtgcaaatatcttagctaaaacaagtcttttattaagccctactttgccaaaa
tcttgtcaaaaagtaggtttggctttaaattttgaaatttctcctacaaactatcaaaaa
cttatcttacaaaatgaacttttagattttaaggctagcgcctgtgaagctttatttcca
aaaatagaaaaacctctcttatctcaagaagaaaaacaagaagtcaaaaaagaagaaaag
cctaaaatcaaaatcgatgattttgcaaaaatagagattaaggtagccaaggtgattgat
tgtcaaaatatagaaggcagtgaaaaacttttaaaatttaaactcgaacttgacaataaa
gaaattcgtcaagtgctttcaggtattgctaagtattataaagcaagcgatttgatagga
aagcaagtttgtgttataagcaatcttaaaaaagctaagatttttggacatgaaagcgat
ggtatgatactttctgcaaaaagcggggataaacttgtgctcataagccctgaacaactt
gtagaaaacggctctttagtaggctag

DBGET integrated database retrieval system