KEGG   Campylobacter coli RM5611: YSU_08615Help
Entry
YSU_08615         CDS       T03167                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
ccoi  Campylobacter coli RM5611
Pathway
ccoi03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ccoi00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    YSU_08615
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ccoi03011]
    YSU_08615
Ribosome [BR:ccoi03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    YSU_08615
  Bacteria
    YSU_08615
  Archaea
    YSU_08615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 HC2
Motif
Other DBs
NCBI-ProteinID: AHK75883
Position
complement(1657550..1657957)
Genome map
AA seq 135 aa AA seqDB search
MSKALIKFIRLSPTKARLIAREVQGMNAELAMASLKFMPNKGAKYIANAISSAVANGGFE
ANEVVVKSCRVDAGAVLKRFRPRARGSASRIRKPTSHILVEVAKAEVKTEAKKAVAKKTP
VKKTSTKKVTAEKES
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagcattaattaaattcataagattatctccaactaaagcaagattgattgct
agagaagttcaggggatgaatgcagaattagctatggctagtttaaaatttatgccaaac
aagggtgccaaatatatcgcaaatgcaatttcaagtgcagtagcaaacggcggttttgaa
gcgaacgaagtagtggtaaaaagttgtcgtgtagatgctggtgctgtattaaaaagattt
agaccacgtgctagaggaagtgcaagccgtattagaaaacctacttcacatatcttagta
gaagtagcgaaagcggaagttaaaactgaagcaaaaaaagcagtagctaaaaaaactcct
gttaaaaaaacaagtactaaaaaagtaacggcagaaaaggaaagctaa

DBGET integrated database retrieval system