KEGG   Campylobacter coli 76339: BN865_00320Help
Entry
BN865_00320       CDS       T02811                                 

Definition
(GenBank) Malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
ccol  Campylobacter coli 76339
Pathway
ccol00020  Citrate cycle (TCA cycle)
ccol00620  Pyruvate metabolism
ccol01100  Metabolic pathways
ccol01110  Biosynthesis of secondary metabolites
ccol01120  Microbial metabolism in diverse environments
ccol01130  Biosynthesis of antibiotics
ccol01200  Carbon metabolism
Module
ccol_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ccol_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ccol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN865_00320
   00620 Pyruvate metabolism
    BN865_00320
Enzymes [BR:ccol01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     BN865_00320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Pyr_redox_2 NAD_binding_9 NAD_binding_8 3Beta_HSD K_oxygenase Thi4 Pyr_redox_3 HI0933_like Ribosomal_L17 Sacchrp_dh_NADP FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: CDG56298
Position
29944..31290
Genome map
AA seq 448 aa AA seqDB search
MTQQEFDVVIIGAGISGAALFYELARYTDIKNIALIEKYHAPATLNSKGTSNSQTIHCGD
IETNYTLEKAKKVKRTADMIVKYGLLQNAQNQFMFSHQKMALAVGDIECEYMKKRHEEFS
ELYPYMKFFDKEKIKQIEPKVALGENGRDDRPENICAMGVEAGEVFTTVDFGKMSASLIE
QGQKQGKNTFVAFNQEIVHIEKKDDIFILKTDTYQEYHSKAVVVNAGAHSLYLAHKMNLG
MDKSCWPVAGSFYLTKQKLLNGKVYMVQNPKLPFAALHGDPDLLADMNTRFGPTALVIPK
LERYHGLKSVPEFFEALKLDKTVLKVTLNMFKDSTIRNYIFYNYLFELPFIDKNLFVKDA
KKIVPSLKTSDIYYAKGFGGVRPQVIDKTKGELMLGEASITEIPGIIFNMTPSPGATSCL
GNAERDAKLMCEYLGARFDEDKFASELL
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgactcaacaagaattcgatgtagttatcatcggagcgggaatttctggagcagcttta
ttttatgaacttgcaagatatacagatattaaaaatattgccctgatagaaaaatatcat
gcccctgcaacattaaattccaagggaacaagtaattctcaaaccattcattgtggagat
attgaaaccaactacactctagaaaaagctaaaaaagtcaaaagaactgctgatatgata
gtcaagtatggacttttgcaaaatgctcagaatcaatttatgttttctcatcaaaaaatg
gctttagctgttggtgatatagaatgtgagtatatgaaaaaacgccacgaagaattcagc
gaactttatccttatatgaaattttttgataaagaaaaaattaaacaaatcgaacctaaa
gtagcccttggagaaaatggaagagatgatagacctgaaaatatctgtgctatgggggtt
gaagctggagaagttttcactactgtagattttggaaaaatgagtgcaagcttgattgag
caaggacaaaaacaaggtaaaaatacctttgtagcttttaatcaagaaatcgttcatata
gaaaaaaaagatgatatttttatcttaaaaacagatacctatcaagaataccattctaaa
gctgtagttgtaaatgcaggtgcacattctttgtatttagctcataaaatgaatttgggc
atggataaatcttgttggcctgtagcaggaagtttttatttgaccaagcaaaaactactc
aacggtaaggtatatatggtgcaaaatccaaaactgccttttgcagcccttcacggagat
cctgatttgcttgcagatatgaatactcgttttggtcctactgcactagttattccaaaa
cttgaacgctatcatggtttaaaatccgttcctgaattttttgaagctttaaaactagat
aaaaccgttttaaaagttacattgaatatgtttaaagattcgacgattagaaattatata
ttctataactatctttttgaattaccttttatcgataaaaatttatttgtaaaagatgcc
aagaaaatagtccctagcttaaaaacaagtgatatttattacgcaaaaggttttggagga
gtgcgtcctcaagtaattgataaaaccaaaggagaattgatgctaggcgaagcaagtatc
actgaaattcctggaattatcttcaatatgactccaagccctggtgcaacaagctgttta
ggcaatgctgaaagagatgctaagcttatgtgcgagtatttaggagctagatttgatgag
gataaatttgcttcagaattattgtag

DBGET integrated database retrieval system