KEGG   Campylobacter coli 76339: BN865_04960cHelp
Entry
BN865_04960c      CDS       T02811                                 

Definition
(GenBank) Octaprenyl diphosphate synthase / Dimethylallyltransferase / (2E,6E)-farnesyl diphosphate synthase / Geranylgeranyl diphosphate synthase
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
ccol  Campylobacter coli 76339
Pathway
ccol00900  Terpenoid backbone biosynthesis
ccol01100  Metabolic pathways
ccol01110  Biosynthesis of secondary metabolites
ccol01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ccol00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN865_04960c
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:ccol01006]
    BN865_04960c
Enzymes [BR:ccol01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     BN865_04960c
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     BN865_04960c
Prenyltransferases [BR:ccol01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   BN865_04960c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt NYD-SP28
Motif
Other DBs
NCBI-ProteinID: CDG56739
Position
complement(460584..461423)
Genome map
AA seq 279 aa AA seqDB search
MKELFIKHLENHLPKVQSFHPFFNEALAKMLKAGGKHFRAQLLLGVVQNKAPHLIPNALN
AALALEFIHTYSLIHDDLPAMDNADLRRGTPTLHKSYDETTAILVGDALNTEAFLLLSNL
NLKESIKINLIRTLAFNAGINGMILGQAIDCYFEDKKLNLEELRFLHIHKTAKLIAAALK
MGCEICELDEKESDKIYQIGLKLGLIFQINDDIIDETMSEEESGKPSKHDEHKNSFVNLL
GLENAIQSKEDLINECKNDLNDLDANLAKMIKSLIIKYL
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagaactctttatcaaacatttagaaaatcatctgccaaaggttcaaagcttccat
cctttttttaatgaagctctggcaaaaatgctaaaggcaggtgggaagcactttcgtgct
caattactcctaggagtcgttcaaaataaagcacctcatcttatccccaatgccttaaat
gcggccttagctttagaatttatccatacttactcacttatacacgatgatttacccgct
atggataatgcagatttaagacgcggaacccctactctacataaaagctacgatgaaact
acagctattttagtaggcgatgctttaaataccgaagcttttttacttttatctaattta
aatttaaaagaaagcattaaaatcaatctgattagaactctagcttttaatgcagggatc
aatggtatgattttaggtcaggctattgattgttattttgaagataaaaaattaaattta
gaagaacttcgatttttacatatacacaaaaccgcaaaactcatagcagcagctctaaaa
atgggctgtgaaatttgtgagctcgatgaaaaagaaagtgacaaaatttatcaaataggt
ctaaaactcggacttatttttcaaatcaatgatgatatcattgatgaaacaatgagtgaa
gaagagagtggaaagccaagcaaacacgatgagcataaaaattcttttgtgaatttatta
ggacttgaaaatgctattcaaagcaaggaagatttgattaatgagtgcaaaaatgatctt
aatgatcttgatgctaatttagcgaaaatgattaaaagcttaataattaaatatttataa

DBGET integrated database retrieval system