KEGG   Campylobacter coli 76339: BN865_13020cHelp
Entry
BN865_13020c      CDS       T02811                                 

Definition
(GenBank) Phosphopantothenoylcysteine decarboxylase / Phosphopantothenoylcysteine synthetase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
ccol  Campylobacter coli 76339
Pathway
ccol00770  Pantothenate and CoA biosynthesis
ccol01100  Metabolic pathways
Module
ccol_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:ccol00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BN865_13020c
Enzymes [BR:ccol01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     BN865_13020c
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     BN865_13020c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein
Motif
Other DBs
NCBI-ProteinID: CDG57499
Position
complement(1237954..1239111)
Genome map
AA seq 385 aa AA seqDB search
MKKTILLAISGSIAFYKAYELISLFKKEGFRVKVLLSNGLLKFASKMSFEALADEILCEE
NESWKNSNNHIAFSKDADLILFAPASVNSINKLALGIADNLFIQTLIAANKPLIIAPAAN
TNMYHHFSTQNSLALLKKNQALIIEPISKILACKDEGIGALAEVKDIFNISKRELLKQSF
WCDKEVVISGGGTKEKIDNVRCVSNFSSGKMAKAIADAFYFLGAKVTLLSSVYFDTPYSL
KSFESSRELKELLEQNSNKDYLIMAAAVSDFIPEFKKGKIKKNEHLEGLNLYLRLNEDLL
KNLNFKGKKIGFKMEFDAQNALENAKKSLNDKKLDMVCLNILEEENYFGSSKNEIHFITA
SKIEKSGLKSKQELAFDLVSWCEKI
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaccatacttctagccataagcggtagtatagctttttataaagcttatgag
cttatatctttgtttaaaaaagaaggctttagagtaaaagttttgctttctaatgggctt
ttaaaatttgcttctaaaatgagctttgaggctttagcagatgaaattttatgcgaagag
aatgagagctggaaaaactcaaacaatcatatcgcttttagtaaagatgcggatttgatt
ctttttgcacctgcaagtgtaaattctatcaacaaactagccttaggaatagctgataat
cttttcatacaaaccctaattgctgcaaacaagccattaatcatcgctcctgctgcaaat
accaatatgtatcatcattttagcactcaaaattcactggccttacttaaaaaaaatcaa
gctttgatcatagagccaatttcaaaaattttagcttgtaaggatgagggtatcggagct
ttggctgaagtaaaagatatctttaatataagcaaaagagagcttttaaagcagtcattt
tggtgtgataaagaagtcgtcattagtggtggagggacaaaagaaaagattgataatgtg
cgttgtgtgagtaatttttcaagtggaaaaatggcaaaggcaatcgctgatgcattttat
tttttaggagctaaagtaacacttttgagttcggtttattttgatactccttattctctt
aagagttttgaaagctcgcgagaattaaaagaattgttagagcaaaattcaaataaagat
tatttaatcatggcagcggctgtcagtgattttatacccgaatttaaaaaaggcaaaatc
aaaaaaaatgagcatttagagggtttaaatttgtatttaagattgaatgaagatctgctt
aaaaatttaaattttaaaggtaaaaaaataggctttaagatggaatttgacgctcaaaat
gctttagaaaatgccaaaaaatcgctcaatgataaaaagcttgatatggtttgtctaaat
atcttagaagaggaaaattattttggaagctctaagaatgagattcattttattacagca
agcaagattgaaaaaagcggtttaaaaagcaagcaagaattggcttttgatttggtttct
tggtgtgaaaaaatatga

DBGET integrated database retrieval system