KEGG   Cronobacter condimenti: AFK62_00795Help
Entry
AFK62_00795       CDS       T04060                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
ccon  Cronobacter condimenti
Pathway
ccon00051  Fructose and mannose metabolism
ccon01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    AFK62_00795
Enzymes [BR:ccon01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     AFK62_00795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh AfaD
Motif
Other DBs
NCBI-ProteinID: ALB61145
UniProt: K8A264
Position
complement(163284..164432)
Genome map
AA seq 382 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGIGLTFADVNQTVLDALNARHSYQVRVVGGQEQIDTV
SGVDAVNSTSDDVVTLIAQVDLVTTAVGPVVLERIAPAIAKGLALRKAQGNARPLNIIAC
ENMVRGTSQLKTHVFNALSDDDKTWVEGHVGFVDSAVDRIVPPSASAASDPLEVTVETFS
EWIVDKTQFKGELPTIAGMELTDNLMAFVERKLFTLNTGHAITAYLGKQAGHQTIRDAIL
DEKIRLVVRGAMEESGAVLIKRYGFDDAKHAAYIEKILGRFENPYLKDDVERVGRQPLRK
LSAGDRLIKPLLGTLEYGLPHHNLVLGIAAAMHFRSEEDPQAQELAQLIADKGPQAALAQ
VSGLEADSDVVAEAVNAYNATV
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggcgcaggtaatattggtcgtggctttattggcaaactgctt
gcagacgcgggcatcggcctgacattcgccgacgttaaccagacggtgctggacgcatta
aacgcacgccacagctaccaggtgcgcgtggtcggtggacaggagcagattgataccgta
tccggcgtagacgccgtaaacagcaccagcgacgacgtggtgacgcttatcgctcaggtc
gaccttgtaactaccgccgtcggcccggtcgtgctggaacgcatcgcgccggctatcgcg
aaaggtctggcgttgcgtaaagcgcaaggtaacgcgcgcccgctcaacatcatcgcctgc
gaaaacatggttcgcggcaccagccagctgaaaacgcatgtgtttaacgcactcagcgat
gacgacaaaacctgggtggaaggccatgtcggctttgtcgattccgccgttgaccgtatt
gttccgccgtccgcctctgccgccagtgacccgctggaagtcaccgttgaaaccttcagc
gagtggattgtcgacaaaacccagttcaagggcgagctgccgaccattgcgggtatggaa
ctcaccgacaacctgatggcttttgttgagcgcaagctcttcaccctgaacaccgggcat
gctataaccgcctacctcggaaaacaggccggtcatcagaccattcgcgacgccattctg
gatgagaaaattcgtctggtggtgcgcggtgcgatggaagagagcggcgcggtgctgatt
aaacgttacggctttgacgacgcgaagcatgccgcttacatcgagaagattttaggccgc
tttgaaaacccgtatctcaaagatgacgtggagcgcgtgggccgtcagccgctgcgcaaa
ctgagcgcgggcgaccgtctgatcaaaccgctgctgggcacgctggaatatggcctgccg
caccacaatctggtgctgggtatcgccgcggcgatgcacttccgcagtgaagaagatccg
caggcgcaggagctggcgcagcttatcgccgataaagggccgcaggccgcactggcgcag
gtgtcgggtcttgaggctgacagcgatgtcgtcgctgaagccgtcaacgcgtataacgca
acagtgtaa

DBGET integrated database retrieval system