KEGG   Cronobacter condimenti: AFK62_02430Help
Entry
AFK62_02430       CDS       T04060                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ccon  Cronobacter condimenti
Pathway
ccon00052  Galactose metabolism
ccon00500  Starch and sucrose metabolism
ccon01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccon00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AFK62_02430
   00500 Starch and sucrose metabolism
    AFK62_02430
Enzymes [BR:ccon01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     AFK62_02430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: ALB61428
UniProt: K8AAW9
Position
complement(512949..514358)
Genome map
AA seq 469 aa AA seqDB search
MTTPTLLPAILQAVMKGQPVALGDRHYPHWHLAPVTGLLNDPNGFIHFQGRYHLFYQWNA
LGCQHQHKCWGHWSSADLTHWQHEPLALMPDEEYDRSGCYSGSAVDDNGRLTLCYTGNVK
FDDGTRTAWQCLAVQNAEGGFDKLGPVVPLPGGYTGHVRDPKVWRYGEHWYMVLGAQDLE
RQGKVLLLRSENLWNWENLGEIAGSTLGGLGDAGYMWECPDLFMLDDKAILLCCPQGVTR
EEKRFLNTYPSAYLCGELDYDQAAYHHGPLVELDAGFEFYAPQTTLAEDGRRLLIGWMGV
PDGEEMLQPTVAQGWIHQMTCPRELSLRDGKLCQQPVRELAALRGEAHHVDGTASVLSPL
AAESLELMLESSGDVTLNVADTLRLDWTRDGLRLARRSLDTGEWLYRYWQGEVKRLHMLC
DRSSIEIFINDGEGVMSSRYFPPSPAMLAFEGQAHLRLRYWSLRPCMVE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgactacccccacgctgctgcccgccattttgcaggcggtgatgaaaggccagccggtc
gcgcttggcgatcgccattatccgcactggcatctggcgccggtcaccggcctgttgaac
gacccgaacggttttattcattttcagggccgttaccatctgttttatcagtggaatgcg
ctgggctgccagcatcagcataagtgctgggggcactggagctcagccgatctgacgcac
tggcagcatgagccgctggcgttgatgcctgatgaagaatatgaccgcagcggctgttat
tccggcagcgcggtagatgacaacggacggctcacgctctgctataccggtaatgtgaag
tttgacgacggtacccgcaccgcctggcagtgcctggcggtacaaaacgccgaaggcggt
ttcgacaagctcggtccggtcgtgccgctgcccggcggctacaccggacacgtgcgcgat
ccgaaagtctggcgttacggcgaacactggtacatggtgctcggcgcgcaggatctggaa
cgtcagggcaaagtgctgcttctgcgctccgaaaacctgtggaactgggagaacctgggt
gaaattgccggcagcacgctcggcgggctgggcgacgcagggtacatgtgggagtgtccg
gacctctttatgctggacgacaaggctatcctgctctgctgtccacagggtgtgacgcgc
gaagaaaaacgttttctgaatacttacccgagcgcgtacctgtgcggtgaactggactac
gaccaggcggcatatcaccacggcccgctggtggagctggatgccgggtttgagttttac
gccccgcaaaccacacttgcggaagatggccgccgcctgcttatcggctggatgggcgta
ccggacggcgaagagatgctacagccgacggtggcacagggctggatccaccagatgacc
tgtccacgcgagttgtcgctgcgcgatggcaaactctgccagcaaccggtgcgggagttg
gccgcgctgcgcggtgaagcgcatcacgttgacggcacggcatcggtactctccccgctt
gcggccgaaagcctggagttaatgctggaatcatcgggcgacgtgacgcttaatgtcgcc
gatacgctgcgccttgactggacgcgtgacggcctgcgtctggcgcgccgcagtctcgac
acgggcgagtggctctaccgctactggcaaggcgaggtgaagcgcctgcacatgttgtgc
gatcgctcaagcatcgagatttttataaacgacggcgaaggcgtgatgagcagccgctat
ttcccgccttcacccgccatgcttgccttcgaagggcaggcgcatctccggctgcgctac
tggtcgttgcgcccttgcatggtagaatga

DBGET integrated database retrieval system