KEGG   Cronobacter condimenti: AFK62_10125Help
Entry
AFK62_10125       CDS       T04060                                 

Definition
(GenBank) S-(hydroxymethyl)glutathione dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
ccon  Cronobacter condimenti
Pathway
ccon00010  Glycolysis / Gluconeogenesis
ccon00071  Fatty acid degradation
ccon00350  Tyrosine metabolism
ccon00625  Chloroalkane and chloroalkene degradation
ccon00626  Naphthalene degradation
ccon00680  Methane metabolism
ccon01100  Metabolic pathways
ccon01110  Biosynthesis of secondary metabolites
ccon01120  Microbial metabolism in diverse environments
ccon01130  Biosynthesis of antibiotics
ccon01200  Carbon metabolism
ccon01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ccon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AFK62_10125
  09102 Energy metabolism
   00680 Methane metabolism
    AFK62_10125
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AFK62_10125
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    AFK62_10125
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AFK62_10125
   00626 Naphthalene degradation
    AFK62_10125
Enzymes [BR:ccon01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AFK62_10125
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     AFK62_10125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Met_10 2-Hacid_dh_C Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ALB62838
UniProt: K8A1D5
Position
complement(2216229..2217347)
Genome map
AA seq 372 aa AA seqDB search
MKSRAAVAFGPGKPLEIVEIDVAPPQKGEVLVKITHTGVCHTDAFTLSGEDPEGVFPAVL
GHEGGGVVVEVGEGVTSLKPGDHVIPLYTAECGECKFCKSGKTNLCQAVRATQGKGLMPD
GTTRFSYNGEPIYHYMGTSTFSEYTVVAEISLAKVNPQAPLDKVCLLGCGVTTGIGAVHN
TAKVKEGDTVAVFGLGGIGLAVIQGAVQAKAGRILAVDTNPEKFKLAGEMGATDFVNPKD
YDKPVQDVIVEMTDGGVDFSFECIGNVNVMRAALECCHKGWGESVIIGVAGAGQEIKTRP
FQLVTGRVWRGSAFGGVKGRTQLPGMVEDAMAGKIDLDPFITHRLPLEQINEAFDLMHEG
KSIRTVIHFGDK
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcacgtgcagcagtcgcatttggccccggcaagccgctggaaatcgttgaaatt
gacgtggcaccgccgcaaaagggcgaagtgttggtcaaaattactcataccggcgtgtgt
cacaccgatgcctttacgctctctggcgaagatccggaaggggtattcccggccgtgtta
ggccatgaaggcggcggcgtggtcgtggaagtgggcgaaggcgtcaccagcctgaagccg
ggcgatcatgtgatcccgctttataccgcagagtgcggcgagtgtaagttctgtaaatct
ggcaaaacgaacctctgccaggcggtgcgcgccacccagggcaaaggcctgatgccggac
ggtaccacccgtttctcctacaacggcgagccgatttaccactacatgggcaccagcacc
ttcagtgaatacaccgtggtagctgaaatctcgctcgcgaaagtaaacccgcaggcgccg
cttgataaagtctgcctgctcggctgtggcgtgaccaccggcatcggcgcggtacacaat
acggctaaagtgaaagagggcgacaccgttgcggtgttcggtcttggcgggattggtctt
gcggttattcagggcgcggtccaggcgaaagctggtcgtattctggcggtcgataccaac
ccggagaaattcaaactcgccggtgaaatgggcgcgaccgatttcgttaacccgaaagat
tacgacaaaccggttcaggacgttatcgttgagatgaccgatggcggtgttgacttcagc
ttcgaatgcatcggcaatgtcaacgttatgcgcgcggccctggaatgctgtcataaaggc
tggggtgaaagcgttatcatcggtgttgcaggcgcgggtcaggagatcaaaacgcgtccg
ttccagctggtcacaggccgcgtctggcgcggctctgcgttcggtggcgtgaaagggcgc
acccagttgcctggcatggtggaagatgcgatggcaggcaagattgacctcgatcctttc
atcacgcaccgtctgccgcttgagcagatcaacgaggcgtttgacctgatgcatgaaggg
aaatcgattcgtaccgttattcacttcggcgataaataa

DBGET integrated database retrieval system