KEGG   Cronobacter condimenti: AFK62_16080Help
Entry
AFK62_16080       CDS       T04060                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ccon  Cronobacter condimenti
Pathway
ccon00071  Fatty acid degradation
ccon00280  Valine, leucine and isoleucine degradation
ccon00310  Lysine degradation
ccon00362  Benzoate degradation
ccon00380  Tryptophan metabolism
ccon00620  Pyruvate metabolism
ccon00630  Glyoxylate and dicarboxylate metabolism
ccon00640  Propanoate metabolism
ccon00650  Butanoate metabolism
ccon00900  Terpenoid backbone biosynthesis
ccon01100  Metabolic pathways
ccon01110  Biosynthesis of secondary metabolites
ccon01120  Microbial metabolism in diverse environments
ccon01130  Biosynthesis of antibiotics
ccon01200  Carbon metabolism
ccon01212  Fatty acid metabolism
ccon02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ccon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AFK62_16080
   00630 Glyoxylate and dicarboxylate metabolism
    AFK62_16080
   00640 Propanoate metabolism
    AFK62_16080
   00650 Butanoate metabolism
    AFK62_16080
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AFK62_16080
   00072 Synthesis and degradation of ketone bodies
    AFK62_16080
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AFK62_16080
   00310 Lysine degradation
    AFK62_16080
   00380 Tryptophan metabolism
    AFK62_16080
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AFK62_16080
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AFK62_16080
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AFK62_16080
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccon04147]
    AFK62_16080
Enzymes [BR:ccon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AFK62_16080
Exosome [BR:ccon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AFK62_16080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C DUF840
Motif
Other DBs
NCBI-ProteinID: ALB63922
UniProt: K8A5J6
Position
complement(3523140..3524321)
Genome map
AA seq 393 aa AA seqDB search
MKDVVIVGAARTPIGCFQGALARRSAVELGAVVIEALLARTGLNPEDVDEVILGQVLTAG
AGQNPARQTALNSGLPWSVSAITINDVCGSGLKALHLATQAIQCGEADIIIAGGQENMSR
APHVLTEGRTAAPSHDGHIVDSLVHDGLWDAFNDYHMGVTAENLAREYNISREHQDAYAL
ASQHKARLAIDSGRFRDEIVPVAIEQAQGAPLLVDTDEQPRADTSAEGLARLSPAFDLLG
SVTAGNASSINDGAAAVLMMSASKAQEMGLPVLARIRAFASVGVDPALMGIAPVYATRRC
LERAGWQLNDVDLIEANEAFAAQTLSVGKLLEWDERKVNVNGGAIALGHPIGASGCRILV
SLVHEMVKRQARKGLATLCIGGGQGVALAIERD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacgtggtaattgtgggtgccgcacgcacgcccatcggctgttttcagggggca
ctggcgcgtcgctcagcggtcgagcttggcgctgtcgtcattgaggcgctgctcgcccgt
accgggctaaacccagaggatgtcgacgaggttatcctgggacaggtgctgactgcgggc
gccggtcagaacccggcgcgccagacggcgctcaacagtggactgccgtggtcggtgtca
gccattaccatcaatgacgtctgcggctccgggcttaaggcgctgcatctcgcgacccag
gctatccagtgtggcgaagcggatatcattatcgcaggtggccaggagaatatgagccgt
gccccgcatgtactgaccgagggacgcaccgccgcgccgtcgcacgacggccacattgtt
gatagcctggtgcatgacggcttatgggacgcgttcaacgattaccatatgggtgtgacg
gcggaaaatctggcgcgcgaatataacatcagccgcgaacatcaggatgcgtatgcgctg
gcgtctcaacacaaggcacggctcgcgatagacagcggccggtttcgtgacgagattgta
ccggtggctattgagcaggcgcagggcgcgccgctgctggtcgataccgatgaacagccg
cgtgcggacaccagcgcagaggggttagcgcggctgtcgccagcgttcgatttgctcggg
agcgtcacggcgggtaacgcctcgtccatcaatgacggcgcggcggcggtgctgatgatg
agcgcgagcaaggcgcaggagatggggttaccggtgctggcgcgcattcgtgctttcgca
agcgtgggtgttgatcctgcactgatgggtattgcgccggtatacgctacacggcgctgt
ctggaacgtgcgggctggcagcttaatgatgtggatcttatcgaagcgaacgaagcattc
gcggcgcagacgctctcggtcggcaaactgctggagtgggatgagcgtaaggtaaacgtt
aacggtggcgccattgcgctgggccatcctatcggcgcgtcgggctgccgtattttggtt
tcgctggtgcatgaaatggtgaagcgccaggcgcgtaaagggctggcgaccctctgtatc
ggcggtggccagggcgtagcgctggcaatcgagcgcgattaa

DBGET integrated database retrieval system