KEGG   Campylobacter coli OR12: ATE51_01294Help
Entry
ATE51_01294       CDS       T04527                                 

Gene name
hldD
Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
ccoo  Campylobacter coli OR12
Pathway
ccoo00540  Lipopolysaccharide biosynthesis
ccoo01100  Metabolic pathways
Module
ccoo_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:ccoo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    ATE51_01294 (hldD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:ccoo01005]
    ATE51_01294 (hldD)
Enzymes [BR:ccoo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     ATE51_01294 (hldD)
Lipopolysaccharide biosynthesis proteins [BR:ccoo01005]
 Unusual sugar
  ATE51_01294 (hldD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 Ldh_1_N TrkA_N
Motif
Other DBs
NCBI-ProteinID: ALU99181
UniProt: A0A0U3KK42
Position
644647..645600
Genome map
AA seq 317 aa AA seqDB search
MKIAITGGAGFIGSQLALNLQEKHEILIIDKMRSNATFENGNLQSFGHFKNLLEFDGELF
AGDINDEKVLKKIEDFKPEIIFHQAAISDTTVFDQTKVLQTNLNTFKDFIELSIKLHAKL
IYASSASVYGDAKSPQTVGKDEEPKNPYAFSKLMMDKLAKKYYDKAHLVGLRYFNVYGKG
EFYKNKTASMVLQFGHQILAGKNPRLFEGSDQIYRDFTYIKDVINANLIALESKCGVYNV
GSGVARSFQDIVDILQKELHTNLTCEYIPNPYAKSYQFHTQAKLDETWGYKPKFSLEEGI
RDYLEEIKRLFEKEVNA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagcaatcacaggtggtgcaggatttataggttcgcaactggctttaaatttg
caagaaaaacatgaaattttaatcattgataaaatgcgtagcaatgcgacttttgaaaat
ggaaatttacaaagttttggacattttaaaaatttacttgaatttgatggagaacttttt
gcaggcgatattaacgatgaaaaagttttaaaaaagattgaagattttaagccagagatt
atttttcatcaagcagcaatttcagacactacagtttttgatcaaactaaggttttacaa
accaatttaaatacttttaaagattttatagaactcagcataaaacttcacgcaaagctt
atttatgcaagttcagcttcggtttatggtgatgcaaaaagtccacaaactgtaggtaaa
gatgaagaaccaaaaaatccttatgctttttcaaaattgatgatggataagttagcgaaa
aaatattacgataaagctcatttggtaggacttagatattttaatgtttatggaaaaggc
gaattttataaaaacaaaaccgcttctatggttttgcaatttggccatcaaattttagca
ggaaaaaatccacgtttatttgaaggaagtgatcaaatttatagagattttacttatatt
aaagatgttattaatgccaatttaatcgctcttgaatcaaaatgcggggtttataatgta
ggaagtggagtagcaagaagctttcaagatatagttgatattttacaaaaagaacttcat
acaaatttaacttgcgagtatatccctaatccttatgcaaaatcttatcaatttcatact
caagcaaaattagatgaaacttggggttataagccaaaatttagtttagaagagggtata
agggattatttagaagaaatcaaaagactttttgaaaaggaagtaaatgcttga

DBGET integrated database retrieval system